KLF12 Antibody

Images

 
Western Blot: KLF12 Antibody [NBP1-80010] - Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KLF12 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human KLF12. Peptide sequence MEAVPLLLNNVKGEPPEDSLSVDHFQTQTEPVDLSINKARTSPTAVSSSP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLF12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against KLF12 and was validated on Western blot.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KLF12 Antibody

  • AP-2rep transcription factor
  • AP2REP
  • AP-2rep
  • AP2REPAP-2 repressor
  • HSPC122
  • KLF12 zinc finger transcriptional repressor
  • KLF12
  • Krueppel-like factor 12
  • Kruppel-like factor 12
  • Transcriptional repressor AP-2rep

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-37380
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-20460
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF3758
Species: Hu, Mu
Applications: WB, Simple Western, ICC, KO
AF3158
Species: Mu
Applications: WB, ChIP, ICC
NB100-1051
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, PEP-ELISA
NBP2-48937
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008462-M03
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC-P
NBP2-45511
Species: Hu
Applications: WB, IHC
NBP2-27418
Species: Hu, Pm
Applications: WB
NB200-107
Species: Hu, Mu
Applications: WB, ELISA, Flow, GS, IHC, IHC-Fr, IHC-P
NBP1-87909
Species: Hu, Rt
Applications: IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-14081
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80010
Species: Hu
Applications: WB

Publications for KLF12 Antibody (NBP1-80010) (0)

There are no publications for KLF12 Antibody (NBP1-80010).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLF12 Antibody (NBP1-80010) (0)

There are no reviews for KLF12 Antibody (NBP1-80010). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLF12 Antibody (NBP1-80010) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for KLF12 Antibody (NBP1-80010)

Discover related pathways, diseases and genes to KLF12 Antibody (NBP1-80010). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLF12 Antibody (NBP1-80010)

Discover more about diseases related to KLF12 Antibody (NBP1-80010).
 

Pathways for KLF12 Antibody (NBP1-80010)

View related products by pathway.

PTMs for KLF12 Antibody (NBP1-80010)

Learn more about PTMs related to KLF12 Antibody (NBP1-80010).

Blogs on KLF12

There are no specific blogs for KLF12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLF12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLF12
Entrez
Uniprot