Kir2.1 Antibody

Images

 
Immunohistochemistry: Kir2.1 Antibody [NBP1-87709] - Staining of human colon shows strong cytoplasmic and membrane positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Kir2.1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YEVPNTPLCSARDLAEKKYILSNANSFCYENEVALTSKEEDDSENGVPES
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNJ2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Kir2.1 Protein (NBP1-87709PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Kir2.1 Antibody

  • ATFB9
  • Cardiac inward rectifier potassium channel
  • HHBIRK1
  • HHIRK1
  • HIRK1
  • Inward rectifier K(+) channel Kir2.1
  • inward rectifier K+ channel KIR2.1
  • inward rectifier potassium channel 2
  • IRK1
  • IRK-1
  • IRK1LQT7
  • KCNJ2
  • Kir2.1
  • LQT7
  • Potassium channel, inwardly rectifying subfamily J member 2
  • potassium inwardly-rectifying channel, subfamily J, member 2
  • SQT3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12902
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82874
Species: Hu
Applications: IHC, IHC-P
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB12251
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-12901
Species: Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-12154
Species: Hu
NBP2-01702
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-2756
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-33694
Species: Hu
Applications: IHC, IHC-P
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
H00003753-M01
Species: Hu
Applications: WB, ELISA, RNAi
NBP1-88081
Species: Hu
Applications: WB, IHC, IHC-P
AF4984
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
NBP1-00206
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-20149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-74575
Species: Hu
Applications: WB, PEP-ELISA
NBP2-38146
Species: Hu
Applications: IHC, IHC-P
NBP2-33891
Species: Hu
Applications: IHC, IHC-P
NBP1-87709
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Kir2.1 Antibody (NBP1-87709) (0)

There are no publications for Kir2.1 Antibody (NBP1-87709).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kir2.1 Antibody (NBP1-87709) (0)

There are no reviews for Kir2.1 Antibody (NBP1-87709). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Kir2.1 Antibody (NBP1-87709) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kir2.1 Products

Bioinformatics Tool for Kir2.1 Antibody (NBP1-87709)

Discover related pathways, diseases and genes to Kir2.1 Antibody (NBP1-87709). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kir2.1 Antibody (NBP1-87709)

Discover more about diseases related to Kir2.1 Antibody (NBP1-87709).
 

Pathways for Kir2.1 Antibody (NBP1-87709)

View related products by pathway.

PTMs for Kir2.1 Antibody (NBP1-87709)

Learn more about PTMs related to Kir2.1 Antibody (NBP1-87709).

Blogs on Kir2.1

There are no specific blogs for Kir2.1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kir2.1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNJ2
Entrez