KIN Recombinant Protein Antigen

Images

 
There are currently no images for KIN Recombinant Protein Antigen (NBP2-58750PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KIN Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to KIN.

Source: E. coli

Amino Acid Sequence: IEEQVRRGLEGKEQEVPTFTELSRENDEEKVTFNLSKGACSSSGATSSKSSTLGPSALKTIGSSASVKRKESS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KIN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58750.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KIN Recombinant Protein Antigen

  • antigenic determinant of recA protein (mouse) homolog
  • Binding to curved DNA
  • BTCDDNA/RNA-binding protein KIN17
  • KIN, antigenic determinant of recA protein homolog (mouse)
  • KIN, antigenic determinant of recA protein homolog
  • KIN17antigenic determinant of recA protein homolog

Background

The protein encoded by the KIN gene is a nuclear protein that forms intranuclear foci during proliferation and isredistributed in the nucleoplasm during the cell cycle. Short-wave ultraviolet light provokes the relocalization ofthe protein, suggesting its participation in the cellular response to DNA damage. Originally selected based onprotein-binding with RecA antibodies, the mouse protein presents a limited similarity with a functional domain of thebacterial RecA protein, a characteristic shared by this human ortholog. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-148
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, PLA, WB
H00011004-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, KD, S-ELISA, WB
NBP2-93797
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
7954-GM/CF
Species: Hu
Applications: BA
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP2-02377
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-13754
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-106
Species: Hu, Mu, Po, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, WB
NB100-81798
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-88921
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-2204
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
AF3416
Species: Hu
Applications: WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP3-15868
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-477
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for KIN Recombinant Protein Antigen (NBP2-58750PEP) (0)

There are no publications for KIN Recombinant Protein Antigen (NBP2-58750PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIN Recombinant Protein Antigen (NBP2-58750PEP) (0)

There are no reviews for KIN Recombinant Protein Antigen (NBP2-58750PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KIN Recombinant Protein Antigen (NBP2-58750PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KIN Products

Array NBP2-58750PEP

Research Areas for KIN Recombinant Protein Antigen (NBP2-58750PEP)

Find related products by research area.

Blogs on KIN

There are no specific blogs for KIN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KIN Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KIN