KIFC1 Antibody (2B9)

Images

 
Immunocytochemistry/ Immunofluorescence: KIFC1 Antibody (2B9) [H00003833-M01] - Analysis of monoclonal antibody to KIFC1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: KIFC1 Antibody (2B9) [H00003833-M01] - Analysis of monoclonal antibody to KIFC1 on formalin-fixed paraffin-embedded human lymph node. Antibody concentration 3 ug/ml.
ELISA: KIFC1 Antibody (2B9) [H00003833-M01] - Detection limit for recombinant GST tagged KIFC1 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
2B9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

KIFC1 Antibody (2B9) Summary

Immunogen
KIFC1 (AAH00712, 53 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDPQRSPLLEVKGNIELKRPLIKAPSQLPLSGSRLKRRPDQMEDGLEPEKKRTRGLGATTKITTSHPRVPSLTTVPQTQGQTTAQKVSKKTGPRCSTAIA
Specificity
KIFC1 - kinesin family member C1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KIFC1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactivity against recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publications using H00003833-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KIFC1 Antibody (2B9)

  • HSETMGC1202
  • kinesin family member C1
  • kinesin-like 2
  • Kinesin-like protein 2
  • kinesin-like protein KIFC1
  • Kinesin-related protein HSET
  • KNSL2MGC149736
  • MGC149737

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-174
Species: Hu, Mu, Rt, Ma, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB500-179
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP, KD
NB500-181
Species: Hu, Mu, Rt, Po, Dr, Ma, Pl
Applications: WB, IB, ICC/IF, IP
H00009278-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-59071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
NBP2-93797
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-61832
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56136
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-82875
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31632
Species: Hu
Applications: WB, ICC/IF
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-67460
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-46836
Species: Hu
Applications: WB, IP
NBP2-31769
Species: Hu
Applications: IHC, IHC-P
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-43728
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00003833-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA

Publications for KIFC1 Antibody (H00003833-M01)(4)

Reviews for KIFC1 Antibody (H00003833-M01) (0)

There are no reviews for KIFC1 Antibody (H00003833-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KIFC1 Antibody (H00003833-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KIFC1 Products

Bioinformatics Tool for KIFC1 Antibody (H00003833-M01)

Discover related pathways, diseases and genes to KIFC1 Antibody (H00003833-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIFC1 Antibody (H00003833-M01)

Discover more about diseases related to KIFC1 Antibody (H00003833-M01).
 

Pathways for KIFC1 Antibody (H00003833-M01)

View related products by pathway.

PTMs for KIFC1 Antibody (H00003833-M01)

Learn more about PTMs related to KIFC1 Antibody (H00003833-M01).
 

Research Areas for KIFC1 Antibody (H00003833-M01)

Find related products by research area.

Blogs on KIFC1

There are no specific blogs for KIFC1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIFC1 Antibody (2B9) and receive a gift card or discount.

Bioinformatics

Gene Symbol KIFC1
Entrez
OMIM
Uniprot