KIFC1 Antibody (2B9) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
KIFC1 (AAH00712, 53 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDPQRSPLLEVKGNIELKRPLIKAPSQLPLSGSRLKRRPDQMEDGLEPEKKRTRGLGATTKITTSHPRVPSLTTVPQTQGQTTAQKVSKKTGPRCSTAIA |
| Specificity |
KIFC1 - kinesin family member C1 |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
KIFC1 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1:500
|
| Application Notes |
Antibody reactivity against recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for KIFC1 Antibody (2B9) - Azide and BSA Free
Background
Minus end-directed microtubule-dependent motor required for bipolar spindle formation. May contribute to movement of early endocytic vesicles
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Ma, Mar, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Ma, Mu, Po, Rt
Applications: Flow, ICC/IF, IP, KD, Simple Western, WB
Species: Dr, Hu, Ma, Mu, Pl, Po, Rt
Applications: IB, ICC/IF, IP, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IB, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Publications for KIFC1 Antibody (H00003833-M01)(5)
Showing Publications 1 -
5 of 5.
| Publications using H00003833-M01 |
Applications |
Species |
| Akira I, Hiroki F, Takafumi F et al. Expression of kinesin family member C1 in pancreatic ductal adenocarcinoma affects tumor progression and stemness. Pathol Res Pract. 2022-12-19 [PMID: 36565617] |
|
|
| Sekino Y, Oue N, Koike Y et al. KIFC1 Inhibitor CW069 Induces Apoptosis and Reverses Resistance to Docetaxel in Prostate Cancer. J Clin Med. 2019-02-09 [PMID: 30744126] |
|
|
| Shrestha D, Kim N, Song K. Stathmin/Op18 depletion induces genomic instability and leads to premature senescence in human normal fibroblasts. J Cell Biochem 2018-02-01 [PMID: 28885720] |
|
|
| Oue N, Mukai S, Imai T et al. Induction of KIFC1 expression in gastric cancer spheroids. Oncol Rep 2016-04-28 [PMID: 27176706] |
|
|
| Sati L, Seval-Celik Y, Unek G et al. The Presence of Kinesin Superfamily Motor Proteins KIFC1 and KIF17 in Normal and Pathological Human Placenta. Placenta;30(10):848-54. 2009-10-01 [PMID: 19679349] |
|
|
Reviews for KIFC1 Antibody (H00003833-M01) (0)
There are no reviews for KIFC1 Antibody (H00003833-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KIFC1 Antibody (H00003833-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KIFC1 Products
Research Areas for KIFC1 Antibody (H00003833-M01)
Find related products by research area.
|
Blogs on KIFC1