KIFAP3 Antibody

Images

 
Immunohistochemistry-Paraffin: KIFAP3 Antibody [NBP1-81569] - Staining of human adrenal gland shows strong nuclear and cytoplasmic positivity in cortical cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIFAP3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KSSKPKDPPPFEGMEIDEVANINDMDEYIELLYEDIPDKVRGSALILQLARNPDNLEELLLNETALGALARVLREDWKQSVELATNIIYIF
Specificity
Specificity of human KIFAP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIFAP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KIFAP3 Protein (NBP1-81569PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIFAP3 Antibody

  • dJ190I16.1
  • FLJ22818
  • KAP-3
  • KIF3AP
  • kinesin-associated protein 3
  • small G protein GDP dissociation stimulator
  • SMAPKAP3Smg-GDS
  • Smg GDS-associated protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2350
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00011127-B01P-50ug
Species: Hu, Rt
Applications: WB
NBP1-81259
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1724
Species: Hu
Applications: WB, IP
H00009371-B01P
Species: Hu, Rt
Applications: WB, ELISA
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-22568
Species: Hu
Applications: IHC-P
NB500-180
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, ICC/IF, IP
AF2428
Species: Hu
Applications: WB
NB100-2596
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-207
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
AF8198
Species: Hu
Applications: ELISA, IHC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-80608
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81569
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for KIFAP3 Antibody (NBP1-81569) (0)

There are no publications for KIFAP3 Antibody (NBP1-81569).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIFAP3 Antibody (NBP1-81569) (0)

There are no reviews for KIFAP3 Antibody (NBP1-81569). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KIFAP3 Antibody (NBP1-81569) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for KIFAP3 Antibody (NBP1-81569)

Discover related pathways, diseases and genes to KIFAP3 Antibody (NBP1-81569). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIFAP3 Antibody (NBP1-81569)

Discover more about diseases related to KIFAP3 Antibody (NBP1-81569).
 

Pathways for KIFAP3 Antibody (NBP1-81569)

View related products by pathway.

PTMs for KIFAP3 Antibody (NBP1-81569)

Learn more about PTMs related to KIFAP3 Antibody (NBP1-81569).

Blogs on KIFAP3

There are no specific blogs for KIFAP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIFAP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIFAP3