KIF2C Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: KIF2C Antibody [NBP3-17038] - Analysis in human testis and pancreas tissues using Anti-KIF2C antibody. Corresponding KIF2C RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: KIF2C Antibody [NBP3-17038] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: KIF2C Antibody [NBP3-17038] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: KIF2C Antibody [NBP3-17038] - Staining of human thymus shows nuclear positivity in a subset of cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KIF2C Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KIF2C Antibody - BSA Free (NBP3-17038) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGATKGKEIDFDDVAAINPELLQLLPLHPKDNLPLQENVTIQK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KIF2C
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for KIF2C Antibody - BSA Free

• kinesin family member 2C
• kinesin-like 6 (mitotic centromere-associated kinesin)
• Kinesin-like protein 6
• kinesin-like protein KIF2C
• MCAKKNSL6kinesin-like 6
• Mitotic centromere-associated kinesin

Background

KIF2C is encoded by this gene is a member of kinesin-like protein family. Proteins of this family are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein is important for anaphase chromosome segregation and may be required to coordinate the onset of sister centromere separation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KIF2C