KIF2B Antibody - BSA Free

Immunohistochemistry-Paraffin: KIF2B Antibody [NBP1-86416] - Staining of human testis shows moderate cytoplasmic and nuclear postivity in seminiferous ducts.

Analysis in control (vector only transfected HEK293T lysate) and KIF2B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KIF2B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KIF2B Antibody - BSA Free (NBP1-86416) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ISPGMTSCENTLNTLRYANRVKKLNVDVRPYHRGHYPIGHEAPRMLKSHIGNSEMSL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KIF2B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  KIF2B Protein (NBP1-86416PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for KIF2B Antibody - BSA Free

• FLJ53902
• kinesin family member 2B
• kinesin protein
• kinesin-like protein KIF2B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KIF2B