KIF2B Antibody

Images

 
Western Blot: KIF2B Antibody [NBP1-86002] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: KIF2B Antibody [NBP1-86002] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIF2B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ALAPSSAIRDQRTATKWVAMIPQKNQTASGDSLDVRVPSKPCLMKQKKSPCLWEIQKLQEQREKRRRLQQEIRARRALDVNTRN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIF2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 26656453).
Control Peptide
KIF2B Protein (NBP1-86002PEP)
Publications
Read Publication using
NBP1-86002 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIF2B Antibody

  • FLJ53902
  • kinesin family member 2B
  • kinesin protein
  • kinesin-like protein KIF2B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01064
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-180
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, ICC/IF, IP
NB100-1059
Species: Hu, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NB100-74638
Species: Hu
Applications: WB (-), ICC/IF, IP
NBP2-16651
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-40844
Species: Hu
Applications: WB, ICC/IF, IHC-P, IP
NBP1-77687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-55411
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-37969
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NBP1-62724
Species: Hu
Applications: WB
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-31992
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for KIF2B Antibody (NBP1-86002)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for KIF2B Antibody (NBP1-86002) (0)

There are no reviews for KIF2B Antibody (NBP1-86002). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KIF2B Antibody (NBP1-86002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIF2B Products

Bioinformatics Tool for KIF2B Antibody (NBP1-86002)

Discover related pathways, diseases and genes to KIF2B Antibody (NBP1-86002). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIF2B Antibody (NBP1-86002)

Discover more about diseases related to KIF2B Antibody (NBP1-86002).
 

Pathways for KIF2B Antibody (NBP1-86002)

View related products by pathway.

PTMs for KIF2B Antibody (NBP1-86002)

Learn more about PTMs related to KIF2B Antibody (NBP1-86002).

Blogs on KIF2B

There are no specific blogs for KIF2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIF2B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF2B