KIF18A Antibody - BSA Free

Immunohistochemistry-Paraffin: KIF18A Antibody [NBP1-85127] - Staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KIF18A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KIF18A Antibody - BSA Free (NBP1-85127) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AFQNPSTVTLMKPSSFTTSFQAISSNINSDNCLKMLCEVAIPHNRRKECGQEDLDSTFTICEDIKSSKCKLPEQESLPNDNKDILQRLDP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KIF18A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  KIF18A Protein (NBP1-85127PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for KIF18A Antibody - BSA Free

• DKFZP434G2226
• KIF18A
• kinesin family member 18A
• kinesin-like protein KIF18A
• Marrow stromal KIF18A
• MS-KIF18A
• OK/SW-cl.108

Background

The kinesin superfamily of proteins consists of over forty KIF motor proteins that function in intracellular transport along microtubules. Kinesin activity has been linked to various cellular functions such as vesicle transport, mitotic spindle formation, chromosome segregation, chromosome congression, and cytokinesis. Structurally, all kinesins contain a motor domain with microtubule and nucleotide binding sites that utilize ATP to target cargo along microtubule filaments. KIF18 has been demonstrated to be a microtubule depolymerase essential for chromosome alignment at the spindle equator. Alternate names for KIF18A include kinesin family member 18A, kinesin-like protein KIF18A, and DKFZP434G2226.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KIF18A