SLC25A22 Antibody

Images

 
Western Blot: SLC25A22 Antibody [NBP1-84880] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: SLC25A22 Antibody [NBP1-84880] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: SLC25A22 Antibody [NBP1-84880] - Staining of human testis shows strong granular positivity in cytoplasm in a subset of cells in seminiferous ducts.
Western Blot: SLC25A22 Antibody [NBP1-84880] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: SLC25A22 Antibody [NBP1-84880] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells and neuropil.
Immunohistochemistry-Paraffin: SLC25A22 Antibody [NBP1-84880] - Staining of human cerebral cortex shows strong granular positivity in cytoplasm in neurons.
Immunohistochemistry-Paraffin: SLC25A22 Antibody [NBP1-84880] - Staining of human prostate shows strong granular positivity in cytoplasm in glandular cells.
Immunohistochemistry-Paraffin: SLC25A22 Antibody [NBP1-84880] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC25A22 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RSEGYFGMYRGAAVNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIVTTPMEMLKIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVE
Specificity
Specificity of human, mouse, rat SLC25A22 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC25A22
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
SLC25A22 Knockout 293T Cell Lysate
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC25A22 Antibody

  • EIEE3mitochondrial glutamate carrier 1
  • FLJ13044
  • GC1GC-1
  • Glutamate/H(+) symporter 1
  • NET44
  • solute carrier family 25 (mitochondrial carrier: glutamate), member 22
  • Solute carrier family 25 member 22

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00083733-Q01
Species: Hu
NBP2-57642
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55158
Species: Hu
Applications: IHC, IHC-P
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-01863
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20619
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-68721
Species: Hu
Applications: WB, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB200-305
Species: Hu, Mu, Mk, Rb
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-84880
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SLC25A22 Antibody (NBP1-84880) (0)

There are no publications for SLC25A22 Antibody (NBP1-84880).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A22 Antibody (NBP1-84880) (0)

There are no reviews for SLC25A22 Antibody (NBP1-84880). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SLC25A22 Antibody (NBP1-84880) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC25A22 Products

Bioinformatics Tool for SLC25A22 Antibody (NBP1-84880)

Discover related pathways, diseases and genes to SLC25A22 Antibody (NBP1-84880). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A22 Antibody (NBP1-84880)

Discover more about diseases related to SLC25A22 Antibody (NBP1-84880).
 

Pathways for SLC25A22 Antibody (NBP1-84880)

View related products by pathway.

Blogs on SLC25A22

There are no specific blogs for SLC25A22, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC25A22 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A22
Novus 100% Guarantee