KIF15 Antibody

Images

 
Western Blot: KIF15 Antibody [NBP1-83252] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-292
Immunohistochemistry-Paraffin: KIF15 Antibody [NBP1-83252] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIF15 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ESLLATEKVISSLEKSRDSDKKVVADLMNQIQELRTSVCEKTETIDTLKQELKDINCKYNSALVDREESRVLIKKQEVDILD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIF15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
160 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
KIF15 Protein (NBP1-83252PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIF15 Antibody

  • FLJ25667
  • HKLP2
  • kinesin family member 15
  • kinesin-like 7
  • Kinesin-like protein 2
  • Kinesin-like protein 7
  • kinesin-like protein KIF15
  • KLP2
  • KNSL7
  • NY-BR-62
  • Serologically defined breast cancer antigen NY-BR-62

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-179
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP
NB500-181
Species: Hu, Mu, Rt, Po, Dr
Applications: WB, ICC/IF, IP
NBP2-17299
Species: Hu
Applications: WB, ICC/IF
NBP1-88856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010849-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-17052
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NB500-182
Species: Hu, Mu, Rt, Ma
Applications: WB, ICC/IF, IP
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP2-36749
Species: Hu
Applications: ICC/IF, IHC
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00009278-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-37471
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-40844
Species: Hu
Applications: WB, ICC/IF, IHC-P, IP
NB100-1059
Species: Hu, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
NB500-174
Species: Hu, Mu, Rt, Ma, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-38794
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83252
Species: Hu
Applications: WB, IHC, IHC-P

Publications for KIF15 Antibody (NBP1-83252) (0)

There are no publications for KIF15 Antibody (NBP1-83252).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF15 Antibody (NBP1-83252) (0)

There are no reviews for KIF15 Antibody (NBP1-83252). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KIF15 Antibody (NBP1-83252) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIF15 Products

Bioinformatics Tool for KIF15 Antibody (NBP1-83252)

Discover related pathways, diseases and genes to KIF15 Antibody (NBP1-83252). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIF15 Antibody (NBP1-83252)

Discover more about diseases related to KIF15 Antibody (NBP1-83252).
 

Pathways for KIF15 Antibody (NBP1-83252)

View related products by pathway.

PTMs for KIF15 Antibody (NBP1-83252)

Learn more about PTMs related to KIF15 Antibody (NBP1-83252).

Blogs on KIF15.

Ki67 - an established marker for labelling proliferating cells
Ki-67/MKI67 is an antigen which is expressed during G1, S, G2, and M phases of the cell cycle (mitotically active cells), but not during G0 phase (resting cells). It is a large protein with expected molecular weight of about 395 kDa, and it has a v...  Read full blog post.

Ki67 - A Crucial Cellular Proliferation Marker
The Ki67 antigen is a prototypic cell cycle-related protein expressed by proliferating cells in all phases of the active cell cycle (G1, S, G2 and M). It is a non-histone nuclear protein originally identified in a Hodgkin's lymphoma-derived cell line....  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIF15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF15
Entrez
Uniprot