KIF12 Antibody

Images

 
Western Blot: KIF12 Antibody [NBP1-86029] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: KIF12 Antibody [NBP1-86029] - Staining of human stomach shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIF12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AKCPRERSHSDWTQTRVLAEMLTEEEVVPSAPPLPVRPPKTSPGLRGGAGVPNLAQRLEALRDQIGSSLRRGRSQPPCSEGARSPGQVLPPH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIF12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KIF12 Protein (NBP1-86029PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIF12 Antibody

  • kinesin family member 12
  • kinesin-like protein KIF12
  • RP11-56P10.3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46395
Species: Hu
Applications: WB, IHC
AF1028
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-37471
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
BC110-60480
Species: Hu, Mu
Applications: ICC/IF, PEP-ELISA
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
MAB7442
Species: Hu
Applications: WB, B/N
AF5068
Species: Hu
Applications: WB
H00000259-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-06529
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP1-90535
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for KIF12 Antibody (NBP1-86029) (0)

There are no publications for KIF12 Antibody (NBP1-86029).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF12 Antibody (NBP1-86029) (0)

There are no reviews for KIF12 Antibody (NBP1-86029). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KIF12 Antibody (NBP1-86029). (Showing 1 - 1 of 1 FAQ).

  1. Could I please get the concentration for the last batch of KIF1 antibody - NBP1-86029?
    • The concentration of the most recent lot, lot R10650, of NBP1-86029 is 0.1 mg/ml.

Secondary Antibodies

 

Isotype Controls

Additional KIF12 Products

Bioinformatics Tool for KIF12 Antibody (NBP1-86029)

Discover related pathways, diseases and genes to KIF12 Antibody (NBP1-86029). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIF12 Antibody (NBP1-86029)

Discover more about diseases related to KIF12 Antibody (NBP1-86029).
 

Pathways for KIF12 Antibody (NBP1-86029)

View related products by pathway.

PTMs for KIF12 Antibody (NBP1-86029)

Learn more about PTMs related to KIF12 Antibody (NBP1-86029).

Blogs on KIF12

There are no specific blogs for KIF12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIF12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF12