![Immunocytochemistry/Immunofluorescence: TMEM268 Antibody [NBP1-90535] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol.](http://images.novusbio.com/fullsize/TMEM268-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90535-img0008.jpg "Immunocytochemistry/Immunofluorescence: TMEM268 Antibody [NBP1-90535] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit TMEM268 Antibody - BSA Free (NBP1-90535) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SVIQLWFVYFDLENCVQFLSDHVQEMKTSQESLLRSRLSQLCVVMETGVSPATAEGPENLEDAPLLPGNSCPNERPLMQTELHQLVPEAEPEEMARQLLAVFGGYYIRLLVTSQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | C9ORF91 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | C9ORF91 |
![Immunohistochemistry-Paraffin: TMEM268 Antibody [NBP1-90535] - Staining of human lymph node shows strong cytoplasmic/ membranous positivity in a small subset of lymphoid cells.](http://images.novusbio.com/fullsize/TMEM268-Antibody-Immunohistochemistry-Paraffin-NBP1-90535-img0011.jpg "Immunohistochemistry-Paraffin: TMEM268 Antibody [NBP1-90535] - Staining of human lymph node shows strong cytoplasmic/ membranous positivity in a small subset of lymphoid cells.")
![Immunohistochemistry-Paraffin: TMEM268 Antibody [NBP1-90535] - Staining of human cerebellum shows strong cytoplasmic and membranous positivity in Purkinje cells.](http://images.novusbio.com/fullsize/TMEM268-Antibody-Immunohistochemistry-Paraffin-NBP1-90535-img0009.jpg "Immunohistochemistry-Paraffin: TMEM268 Antibody [NBP1-90535] - Staining of human cerebellum shows strong cytoplasmic and membranous positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: TMEM268 Antibody [NBP1-90535] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/TMEM268-Antibody-Immunohistochemistry-Paraffin-NBP1-90535-img0010.jpg "Immunohistochemistry-Paraffin: TMEM268 Antibody [NBP1-90535] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: TMEM268 Antibody [NBP1-90535] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.](http://images.novusbio.com/fullsize/TMEM268-Antibody-Immunohistochemistry-Paraffin-NBP1-90535-img0012.jpg "Immunohistochemistry-Paraffin: TMEM268 Antibody [NBP1-90535] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.")
![Immunohistochemistry CD30 Ligand/TNFSF8 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD30_Ligand_AF1028_Immunohistochemistry_20252.jpg)
![Immunohistochemistry CD30 Ligand/TNFSF8 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD30_Ligand_AF1028_Immunohistochemistry_20253.jpg)
![Flow Cytometry CD30 Ligand/TNFSF8 Antibody [Unconjugated]](https://images.novusbio.com/images2/af1028_human-cd30-ligand-tnfsf8-affinity-purified-polyclonal-ab-flow-cytometry-286202212274.jpg)
![Western Blot alpha 1-Acid Glycoprotein Antibody (386131) [Unconjugated]](https://images.novusbio.com/images2/alpha_1-Acid_Glycoprotein_MAB3694_Western_Blot_6125.jpg)
![Western Blot alpha 1-Acid Glycoprotein Antibody (386131) [Unconjugated]](https://images.novusbio.com/images2/alpha_1Acid_Glycoprotein_MAB3694_Western_Blot_21887.jpg)
![Immunohistochemistry alpha 1-Acid Glycoprotein Antibody (386131) [Unconjugated]](https://images.novusbio.com/images2/alpha_1-Acid_Glycoprotein_MAB3694_Immunohistochemistry_9988.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")