IQGAP2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: IQGAP2 Antibody [NBP2-37885] - Immunofluorescent staining of human cell line CACO-2 shows localization to plasma membrane & vesicles.

Immunohistochemistry-Paraffin: IQGAP2 Antibody [NBP2-37885] - Staining of human prostate cancer shows strong membranous and cytoplasmic positivity in tumor cells.

Immunohistochemistry-Paraffin: IQGAP2 Antibody [NBP2-37885] -Staining of human prostate shows moderate membranous and cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: IQGAP2 Antibody [NBP2-37885] -Staining of human small intestine shows strong membranous and cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: IQGAP2 Antibody [NBP2-37885] -Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IQGAP2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DANVDKDRAKQWVTLVVDVNQCLEGKKSSDILSVLKSSTSNANDIIPECADKYYDALVKAKELKSERVSSDGSWLKLNLHKKYDYYYNTDS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IQGAP2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  IQGAP2 Protein (NBP2-37885PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IQGAP2 Antibody - BSA Free

• IQ motif containing GTPase activating protein 2
• IQGAP2
• ras GTPase-activating-like protein IQGAP2

Background

The IQGAP2 gene encodes a member of the IQGAP family. The protein contains three IQ domains, one calponin homology domain, one Ras-GAP domain and one WW domain. It interacts with components of the cytoskeleton, with cell adhesion molecules, and with several sig

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IQGAP2
• Uniprot:
  • Q13576()