![Immunocytochemistry/Immunofluorescence: IQGAP2 Antibody [NBP2-37885] - Immunofluorescent staining of human cell line CACO-2 shows localization to plasma membrane & vesicles.](http://images.novusbio.com/fullsize2/IQGAP2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-37885-img0004.jpg "Immunocytochemistry/Immunofluorescence: IQGAP2 Antibody [NBP2-37885] - Immunofluorescent staining of human cell line CACO-2 shows localization to plasma membrane & vesicles.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DANVDKDRAKQWVTLVVDVNQCLEGKKSSDILSVLKSSTSNANDIIPECADKYYDALVKAKELKSERVSSDGSWLKLNLHKKYDYYYNTDS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | IQGAP2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Immunocytochemistry-Immunofluorescence-NB120-2860-img0015.jpg)
-Immunocytochemistry-Immunofluorescence-NB120-2860-img0016.jpg)
-Immunocytochemistry-Immunofluorescence-NB120-2860-img0017.jpg)
![Western Blot AKT [p Ser473] Antibody - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
-ELISA-H00009076-M01-img0017.jpg)
-Immunohistochemistry-Paraffin-H00009076-M01-img0009.jpg)
-Immunohistochemistry-Paraffin-H00009076-M01-img0011.jpg)
-Immunohistochemistry-Frozen-NBP2-59690-img0002.jpg)
-Western-Blot-NBP2-59690-img0004.jpg)
-Immunohistochemistry-NBP2-59690-img0006.jpg)
![Simple Western alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/16253.jpg)
![Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/alphaFetoprotein_MAB1368_Knockout_Validated_21503.jpg)
![Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/alphaFetoprotein_MAB1368_Knockout_Validated_22402.jpg)
-Flow-Cytometry-NBP1-54467-img0012.jpg)
-Western-Blot-NBP1-54467-img0001.jpg)
-Immunohistochemistry-NBP1-54467-img0011.jpg)
-Western-Blot-H00010097-M01-img0002.jpg)
-Immunohistochemistry-Paraffin-H00010097-M01-img0007.jpg)
-Sandwich-ELISA-H00010097-M01-img0008.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for IQGAP2 Antibody (NBP2-37885)Discover more about diseases related to IQGAP2 Antibody (NBP2-37885).
| Pathways for IQGAP2 Antibody (NBP2-37885)View related products by pathway.
|
PTMs for IQGAP2 Antibody (NBP2-37885)Learn more about PTMs related to IQGAP2 Antibody (NBP2-37885).
| Research Areas for IQGAP2 Antibody (NBP2-37885)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: IQGAP2 Antibody [NBP2-37885] - Staining of human gallbladder shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize2/IQGAP2-Antibody-Immunohistochemistry-Paraffin-NBP2-37885-img0003.jpg "Immunohistochemistry-Paraffin: IQGAP2 Antibody [NBP2-37885] - Staining of human gallbladder shows strong membranous positivity in glandular cells.")
-Knockdown-Validated-H00008826-M01-img0011.jpg)
-Western-Blot-H00008826-M01-img0012.jpg)
-Immunocytochemistry-Immunofluorescence-H00008826-M01-img0006.jpg)
-Immunocytochemistry-Immunofluorescence-H00128239-M01-img0003.jpg)
-Immunoprecipitation-H00128239-M01-img0004.jpg)
-Western-Blot-H00128239-M01-img0006.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")