KIDINS220 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: EPLLEIDGDIRNFEVFLSSRTPVLVARDVKVFLPCTVNLDPKLREIIADVRAAREQISIGGLAYPPLPLHEGPPRAPSGYSQPPSVCSSTSFNGPFAGGVVS |
| Predicted Species |
Mouse (92%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KIDINS220 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for KIDINS220 Antibody - BSA Free
Background
KIDINS220 is a novel protein kinase D-interacting substrate of 220 kDa (Kidins220) is the first identified Protein kinase D (PKD), a serine/threonine kinase. Kidins220 is an integral membrane protein that is expressed in brain and neuroendocrine cells. Kidins220 is phosphorylated by PKD at serine 919 in vivo. Kidins220 has also been shown to function downstream of the Trks and Eph receptors.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, WB
Species: Rt
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Ch, Hu, Mu, Rt
Applications: ICC, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, WB
Species: Mu
Applications: ELISA
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Publications for KIDINS220 Antibody (NBP1-88995) (0)
There are no publications for KIDINS220 Antibody (NBP1-88995).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KIDINS220 Antibody (NBP1-88995) (0)
There are no reviews for KIDINS220 Antibody (NBP1-88995).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KIDINS220 Antibody (NBP1-88995) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KIDINS220 Products
Research Areas for KIDINS220 Antibody (NBP1-88995)
Find related products by research area.
|
Blogs on KIDINS220