Hemoglobin beta Antibody (7B12)

Images

 
Immunohistochemistry-Paraffin: Hemoglobin beta Antibody (7B12) [H00003043-M02] - Analysis of monoclonal antibody to HBB on formalin-fixed paraffin-embedded human lung. Antibody concentration 3 ug/ml.
ELISA: Hemoglobin beta Antibody (7B12) [H00003043-M02] - Detection limit for recombinant GST tagged HBB is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P
Clone
7B12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Hemoglobin beta Antibody (7B12) Summary

Immunogen
HBB (AAH07075, 38 a.a. ~ 147 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALPHKYH
Specificity
HBB - hemoglobin, beta
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HBB
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.
Publications
Read Publications using H00003043-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Hemoglobin beta Antibody (7B12)

  • beta globin chain
  • beta-globin
  • CD113t-C
  • HBBB
  • HBD
  • Hemoglobin beta chain
  • hemoglobin subunit beta
  • hemoglobin, beta

Background

The alpha (HBA) and beta (HBB) loci determine the structure of the 2 types of polypeptide chains in adult hemoglobin, Hb A. The normal adult hemoglobin tetramer consists of two alpha chains and two beta chains. Mutant beta globin causes sickle cell anemia. Absence of beta chain causes beta-zero-thalassemia. Reduced amounts of detectable beta globin causes beta-plus-thalassemia. The order of the genes in the beta-globin cluster is 5'-epsilon -- gamma-G -- gamma-A -- delta -- beta--3'.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-09253
Species: Dr
Applications: WB
NBP3-05569
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF
NBP1-47492
Species: Hu, Pm
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-37380
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-43557
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-574
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82257
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP3-04883
Species: Hu, Mu, Rt
Applications: WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-38323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Hemoglobin beta Antibody (H00003043-M02)(2)

Reviews for Hemoglobin beta Antibody (H00003043-M02) (0)

There are no reviews for Hemoglobin beta Antibody (H00003043-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hemoglobin beta Antibody (H00003043-M02). (Showing 1 - 1 of 1 FAQs).

  1. What are the concentrations of H00003043M02, H00003043M12 and NBP2-32769. Also, do these antibodies  detect glycosylated hemoglobin specifically.
    • For both H00003043M02 and H00003043M12 have the concentration of 1.0 mg/ml. H00003043M02 and H00003043M12 have not been verified for the purpose of detecting glycosylated hemoglobin.If you look for antibodies specifically for detection of glycosylated hemoglobin, I’ll recommend the followings:MAB0030-M06 Human HbA1c monoclonal antibody, clone 1D3MAB0030-M06A Human HbA1c monoclonal antibody, clone 1D3MAB0030-M01 Human HbA1c monoclonal antibody, clone 1E4MAB0030-M03 Human HbA1c monoclonal antibody, clone 2A10MAB0030-M05 Human HbA1c monoclonal antibody, clone 2A3MAB0030-M02 Human HbA1c monoclonal antibody, clone 2H5MAB0030-M04 Human HbA1c monoclonal antibody, clone 4B10MAB0030-M07 Human HbA1c monoclonal antibody, clone 7E2For NBP2-32769, the concentration is 6.3 mg/ml for the current lot and it reacts with glycated hemoglobin and it does not cross-react with non-glycated hemoglobin.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Hemoglobin beta Products

Bioinformatics Tool for Hemoglobin beta Antibody (H00003043-M02)

Discover related pathways, diseases and genes to Hemoglobin beta Antibody (H00003043-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hemoglobin beta Antibody (H00003043-M02)

Discover more about diseases related to Hemoglobin beta Antibody (H00003043-M02).
 

Pathways for Hemoglobin beta Antibody (H00003043-M02)

View related products by pathway.

PTMs for Hemoglobin beta Antibody (H00003043-M02)

Learn more about PTMs related to Hemoglobin beta Antibody (H00003043-M02).

Blogs on Hemoglobin beta

There are no specific blogs for Hemoglobin beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hemoglobin beta Antibody (7B12) and receive a gift card or discount.

Bioinformatics

Gene Symbol HBB
Entrez
OMIM
Uniprot