KF1 Antibody - BSA Free

Western Blot: KF1 Antibody [NBP3-09986] - Western blot analysis of KF1 in Breast Tumor lysates. Antibody dilution at 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

KF1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KF1 Antibody - BSA Free (NBP3-09986) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KF1 (NP_001185880.1). Peptide sequence HPALFLSTYLGHGLLIDYFEKKRRRNNNNDEVNANNLEWLSSLWDWYTSY
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNF103
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 75 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for KF1 Antibody - BSA Free

• E3 ubiquitin-protein ligase RNF103
• EC 6.3.2.-
• hkf-1
• KF-1
• KF1ZFP103ZFP-103
• MGC102815
• ring finger protein 103MGC41857
• Zfp-103
• zinc finger protein 103 homolog (mouse)
• Zinc finger protein 103 homolog
• zinc finger protein expressed in cerebellum

Background

KF1 is encoded by this gene contains a RING-H2 finger, a motif known to be involved in protein-protein and protein-DNA interactions. This gene is highly expressed in normal cerebellum, but not in the cerebral cortex. The expression of the rat counterpart in the frontal cortex and hippocampus was shown to be induced by elctroconvulsive treatment (ECT) as well as chronic antidepressant treatment, suggesting that this gene may be a molecular target for ECT and antidepressants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RNF103