Ketohexokinase Antibody (2B1)

Images

 
Western Blot: Ketohexokinase Antibody (2B1) [H00003795-M07] - Analysis of KHK expression in Jurkat (Cat # L017V1).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2B1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Ketohexokinase Antibody (2B1) Summary

Immunogen
KHK (NP_000212, 201 a.a. ~ 297 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGI
Specificity
KHK - ketohexokinase (fructokinase) (2B1)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KHK
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Ketohexokinase Antibody (2B1)

  • EC 2.7.1.3
  • Fructokinase
  • Hepatic fructokinase
  • ketohexokinase (fructokinase)
  • Ketohexokinase
  • KHK

Background

This gene encodes ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The product of this gene is the first enzyme with a specialized pathway that catabolizes dietary fructose. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47980
Species: Hu, Pm
Applications: Flow, IHC, IHC-P, IP, WB
NBP1-47778
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-236
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, IP, WB
NBP1-84127
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-16735
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DCP00
Species: Hu
Applications: ELISA
NBP1-87416
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83292
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-02164
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF4538
Species: Hu, Mu, Rt
Applications: WB
NBP2-03396
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-03621
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-15687
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-00161
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-90233
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-92824
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-00649
Species: Ca, Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB300-956
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-62658
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB

Publications for Ketohexokinase Antibody (H00003795-M07) (0)

There are no publications for Ketohexokinase Antibody (H00003795-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ketohexokinase Antibody (H00003795-M07) (0)

There are no reviews for Ketohexokinase Antibody (H00003795-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ketohexokinase Antibody (H00003795-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ketohexokinase Products

Bioinformatics Tool for Ketohexokinase Antibody (H00003795-M07)

Discover related pathways, diseases and genes to Ketohexokinase Antibody (H00003795-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ketohexokinase Antibody (H00003795-M07)

Discover more about diseases related to Ketohexokinase Antibody (H00003795-M07).
 

Pathways for Ketohexokinase Antibody (H00003795-M07)

View related products by pathway.

PTMs for Ketohexokinase Antibody (H00003795-M07)

Learn more about PTMs related to Ketohexokinase Antibody (H00003795-M07).
 

Research Areas for Ketohexokinase Antibody (H00003795-M07)

Find related products by research area.

Blogs on Ketohexokinase

There are no specific blogs for Ketohexokinase, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ketohexokinase Antibody (2B1) and receive a gift card or discount.

Bioinformatics

Gene Symbol KHK
Entrez
Uniprot