We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

UTY Antibody - BSA Free

Images

 
Western Blot: UTY Antibody [NBP3-11015] - Western blot analysis of UTY in Human Hela Whole Cell lysates. Antibody dilution at 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.5 mg/ml

Order Details

UTY Antibody - BSA Free Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human UTY (NP_009056). Peptide sequence LYETQRKYHSAKEAYEQLLQTENLPAQVKATVLQQLGWMHHNMDLVGDKA
Clonality
Polyclonal
Host
Rabbit
Gene
UTY
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
154 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP3-11015 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for UTY Antibody - BSA Free

  • DKFZp686L12190
  • EC 1.14.11
  • EC 1.14.11.-
  • EC 1.14.11.68
  • histone demethylase UTY
  • KDM6C
  • tetratricopeptide repeat protein
  • ubiquitous TPR motif protein UTY
  • ubiquitously transcribed tetratricopeptide repeat gene, Y chromosome
  • ubiquitously transcribed tetratricopeptide repeat gene, Y-linked
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 101
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 106
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 11
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 118
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 121
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 132
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 133
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 136
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 14
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 15
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 16
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 167
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 20
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 228
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 238
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 24
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 252
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 256
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 26
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 264
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 27
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 29
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 47
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 53
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 56
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 64
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 67
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 68
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 75
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 77
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 88
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 89
  • ubiquitously transcribed tetratricopeptide repeat protein Y-linked transcriptvariant 90
  • ubiquitously transcribed TPR gene on Y chromosome
  • ubiquitously transcribed TPR protein on the Y chromosome
  • ubiquitously transcribed Y chromosome tetratricopeptide repeat protein
  • Ubiquitously-transcribed TPR protein on the Y chromosome
  • Ubiquitously-transcribed Y chromosome tetratricopeptide repeat protein
  • UTY
  • UTY1

Background

UTY encodes a protein containing tetratricopeptide repeats which are thought to be involved in protein-protein interactions. This protein is a minor histocompatibility antigen which may induce graft rejection of male stem cell grafts. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-48031
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP3-16073
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-80628
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-41295
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-20948
Species: Hu
Applications: WB
H00001617-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP3-46655
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NB100-81657
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
NBP1-06640
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, WB
AF497
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP3-17556
Species: Hu
Applications: ICC/IF
NBP1-91542
Species: Mu
Applications: WB
H00009087-M05
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB

Publications for UTY Antibody (NBP3-11015)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publication 1 - 1 of 1.
Publication using NBP3-11015 Applications Species
Gelfand B, Argyle D, Olivieri J, Ambati J Survey of commercial antibodies targeting Y chromosome-encoded genes bioRxiv 2023-07-28 (WB, Human) WB Human

Reviews for UTY Antibody (NBP3-11015) (0)

There are no reviews for UTY Antibody (NBP3-11015). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UTY Antibody (NBP3-11015) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UTY Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol UTY