KCC4/SLC12A7 Antibody

Images

 
Western Blot: KCC4/SLC12A7 Antibody [NBP1-85133] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: KCC4/SLC12A7 Antibody [NBP1-85133] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Western Blot: KCC4/SLC12A7 Antibody [NBP1-85133] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA ...read more
Immunohistochemistry-Paraffin: KCC4/SLC12A7 Antibody [NBP1-85133] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: KCC4/SLC12A7 Antibody [NBP1-85133] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KCC4/SLC12A7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AARTQAPPTPDKVQMTWTREKLIAEKYRSRDTSLSGFKDLFSMKPDQSNV
Specificity
Specificity of human KCC4/SLC12A7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC12A7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Publications
Read Publication using
NBP1-85133 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KCC4/SLC12A7 Antibody

  • DKFZp434F076
  • KCC4
  • KCC4Electroneutral potassium-chloride cotransporter 4
  • K-Cl cotransporter 4
  • potassium/chloride transporter KCC4
  • SLC12A7
  • solute carrier family 12 (potassium/chloride transporters), member 7
  • solute carrier family 12 member 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06044
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-06043
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-29513
Species: Mu, Rt
Applications: WB
NB100-75623
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC
NBP1-57622
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb
Applications: WB, IHC, IHC-P
NBP1-44270
Species: Rt
Applications: WB, EM, ICC/IF, IHC, IHC-P
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NBP1-48021
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-58361
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
NB600-749
Species: Hu, Mu, Rt, Rb, Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45650
Species: Hu, Mu, Rt, Mk
Applications: WB, IHC
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003783-D01P
Species: Hu
Applications: WB
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00009943-M16
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85237
Species: Hu
Applications: IHC, IHC-Fr, IHC-P

Publications for KCC4/SLC12A7 Antibody (NBP1-85133)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for KCC4/SLC12A7 Antibody (NBP1-85133) (0)

There are no reviews for KCC4/SLC12A7 Antibody (NBP1-85133). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KCC4/SLC12A7 Antibody (NBP1-85133) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KCC4/SLC12A7 Products

Bioinformatics Tool for KCC4/SLC12A7 Antibody (NBP1-85133)

Discover related pathways, diseases and genes to KCC4/SLC12A7 Antibody (NBP1-85133). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCC4/SLC12A7 Antibody (NBP1-85133)

Discover more about diseases related to KCC4/SLC12A7 Antibody (NBP1-85133).
 

Pathways for KCC4/SLC12A7 Antibody (NBP1-85133)

View related products by pathway.

PTMs for KCC4/SLC12A7 Antibody (NBP1-85133)

Learn more about PTMs related to KCC4/SLC12A7 Antibody (NBP1-85133).

Blogs on KCC4/SLC12A7

There are no specific blogs for KCC4/SLC12A7, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCC4/SLC12A7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC12A7