KCC4/SLC12A7 Antibody - BSA Free

Immunohistochemistry-Paraffin: KCC4/SLC12A7 Antibody [NBP1-85133] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: KCC4/SLC12A7 Antibody [NBP1-85133] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: KCC4/SLC12A7 Antibody [NBP1-85133] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KCC4/SLC12A7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KCC4/SLC12A7 Antibody - BSA Free (NBP1-85133) is a polyclonal antibody validated for use in IHC and WB. Anti-KCC4/SLC12A7 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AARTQAPPTPDKVQMTWTREKLIAEKYRSRDTSLSGFKDLFSMKPDQSNV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC12A7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot Reported in PMID (31911626)
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  KCC4/SLC12A7 Protein (NBP1-85133PEP)

Reactivity Notes

Mouse reactivity reported in (PMID:31911626). Rat (82%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for KCC4/SLC12A7 Antibody - BSA Free

• DKFZp434F076
• KCC4
• KCC4Electroneutral potassium-chloride cotransporter 4
• K-Cl cotransporter 4
• potassium/chloride transporter KCC4
• SLC12A7
• solute carrier family 12 (potassium/chloride transporters), member 7
• solute carrier family 12 member 7

Background

KCC4 mediates electroneutral potassium-chloride cotransport when activated by cell swelling. May mediate K(+) uptake into Deiters' cells in the cochlea and contribute to K(+) recycling in the inner ear. Important for the survival of cochlear outer and inn

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KCC4/SLC12A7 Antibody (NBP1-85133)(2)

Publications using NBP1-85133

• Zhang J, Bhuiyan MIH, Zhang T et al. Modulation of brain cation-Cl- cotransport via the SPAK kinase inhibitor ZT-1a Nat Commun 2020-01-07 [PMID: 31911626] (WB, Human, Mouse)
• Brown TC, Murtha TD, Rubinstein JC et al. SLC12A7 alters adrenocortical carcinoma cell adhesion properties to promote an aggressive invasive behavior Cell Commun Signal. [PMID: 29884238] (WB, Human)

Bioinformatics

• Gene Symbol: SLC12A7