KCC2/SLC12A5 Antibody - BSA Free

Immunohistochemistry-Paraffin: KCC2/SLC12A5 Antibody [NBP2-49674] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: KCC2/SLC12A5 Antibody [NBP2-49674] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: KCC2/SLC12A5 Antibody [NBP2-49674] - Staining in human cerebral cortex and pancreas tissues using anti-SLC12A5 antibody. Corresponding SLC12A5 RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KCC2/SLC12A5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KCC2/SLC12A5 Antibody - BSA Free (NBP2-49674) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ILKQMHLTKNEREREIQSITDESRGSIRRKNPANTRLRLNVPEETAGDSEEKPEEEVQLIHDQSAPSC
• Predicted Species: Mouse (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC12A5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  KCC2/SLC12A5 Recombinant Protein Antigen (NBP2-49674PEP)

Reactivity Notes

Rat (81%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for KCC2/SLC12A5 Antibody - BSA Free

• Electroneutral potassium-chloride cotransporter 2
• hKCC2
• KCC2
• KCC2K-Cl cotransporter 2
• KIAA1176erythroid K-Cl cotransporter 2
• Neuronal K-Cl cotransporter
• SLC12A5
• solute carrier family 12 (potassium/chloride transporter), member 5
• solute carrier family 12 member 5

Background

K-Cl cotransporters are proteins that lower intracellular chloride concentrations below the electrochemical equilibrium potential. The protein encoded by this gene is an integral membrane K-Cl cotransporter that can function in either a net efflux or influx pathway, depending on the chemical concentration gradients of potassium and chloride. The encoded protein can act as a homomultimer, or as a heteromultimer with other K-Cl cotransporters, to maintain chloride homeostasis in neurons. Alternative splicing results in two transcript variants encoding different isoforms. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC12A5