KAT4/TBP Associated Factor 1 Antibody

Images

 
Chromatin Immunoprecipitation: KAT4/TBP Associated Factor 1 Antibody [NBP3-10940] - Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ChIP, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KAT4/TBP Associated Factor 1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human KAT4/TBP Associated Factor 1 (NP_620278). Peptide sequence YEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE
Specificity
Subunit 1
Clonality
Polyclonal
Host
Rabbit
Gene
TAF1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Chromatin Immunoprecipitation
  • Immunohistochemistry
  • Western Blot 1.0 ug/ml
Theoretical MW
215 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for KAT4/TBP Associated Factor 1 Antibody

  • 250kDa
  • BA2R
  • BA2Rdystonia 3 (with Parkinsonism)
  • CCG1
  • CCG1TATA box binding protein (TBP)-associated factor, RNA polymerase II, A, 250kD
  • CCGS
  • Cell cycle gene 1 protein
  • cell cycle, G1 phase defect
  • complementation of cell cycle block, G1-to-S
  • DYT3/TAF1
  • EC 2.7.11
  • EC 2.7.11.1
  • KAT4
  • KAT4/TBP Associated Factor 1
  • NSCL2
  • OF
  • p250
  • TAF(II)250
  • TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor
  • TAF1
  • TAF2A
  • TAF2AN-TAF1
  • TAFII250
  • TAFII-250
  • TAFII250DYT3
  • TBP-associated factor 250 kDa
  • transcription factor TFIID p250 polypeptide
  • Transcription initiation factor TFIID 250 kDa subunit
  • transcription initiation factor TFIID subunit 1
  • XDP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-13174
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-38188
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1334
Species: Hu
Applications: IHC, WB
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, WB
NBP2-17017
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-80705
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: ChIP, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP3-17971
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00008850-M04
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-88996
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-76729
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
NBP2-01223
Species: Hu
Applications: Flow, IHC, IHC-P, WB
H00006879-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
NBP3-10940
Species: Hu, Mu
Applications: WB, ChIP, IHC

Publications for KAT4/TBP Associated Factor 1 Antibody (NBP3-10940) (0)

There are no publications for KAT4/TBP Associated Factor 1 Antibody (NBP3-10940).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KAT4/TBP Associated Factor 1 Antibody (NBP3-10940) (0)

There are no reviews for KAT4/TBP Associated Factor 1 Antibody (NBP3-10940). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ChIP Video Protocol
ChIP Webinar

FAQs for KAT4/TBP Associated Factor 1 Antibody (NBP3-10940) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KAT4/TBP Associated Factor 1 Products

Bioinformatics Tool for KAT4/TBP Associated Factor 1 Antibody (NBP3-10940)

Discover related pathways, diseases and genes to KAT4/TBP Associated Factor 1 Antibody (NBP3-10940). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KAT4/TBP Associated Factor 1 Antibody (NBP3-10940)

Discover more about diseases related to KAT4/TBP Associated Factor 1 Antibody (NBP3-10940).
 

Pathways for KAT4/TBP Associated Factor 1 Antibody (NBP3-10940)

View related products by pathway.

PTMs for KAT4/TBP Associated Factor 1 Antibody (NBP3-10940)

Learn more about PTMs related to KAT4/TBP Associated Factor 1 Antibody (NBP3-10940).
 

Research Areas for KAT4/TBP Associated Factor 1 Antibody (NBP3-10940)

Find related products by research area.

Blogs on KAT4/TBP Associated Factor 1

There are no specific blogs for KAT4/TBP Associated Factor 1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KAT4/TBP Associated Factor 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF1