Home » KAT4/TBP Associated Factor 1 » KAT4/TBP Associated Factor 1 Antibodies » KAT4/TBP Associated Factor 1 Antibody

KAT4/TBP Associated Factor 1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Chromatin Immunoprecipitation: KAT4/TBP Associated Factor 1 Antibody [NBP3-10940] - Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.
Chromatin Immunoprecipitation: KAT4/TBP Associated Factor 1 Antibody [NBP3-10940] - Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ChIP, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

KAT4/TBP Associated Factor 1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human KAT4/TBP Associated Factor 1 (NP_620278). Peptide sequence YEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE
Specificity
Subunit 1
Clonality
Polyclonal
Host
Rabbit
Gene
TAF1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Chromatin Immunoprecipitation
  • Immunohistochemistry
  • Western Blot 1.0 ug/ml
Theoretical MW
215 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for KAT4/TBP Associated Factor 1 Antibody

  • 250kDa
  • BA2R
  • BA2Rdystonia 3 (with Parkinsonism)
  • CCG1
  • CCG1TATA box binding protein (TBP)-associated factor, RNA polymerase II, A, 250kD
  • CCGS
  • Cell cycle gene 1 protein
  • cell cycle, G1 phase defect
  • complementation of cell cycle block, G1-to-S
  • DYT3/TAF1
  • EC 2.7.11
  • EC 2.7.11.1
  • KAT4
  • KAT4/TBP Associated Factor 1
  • NSCL2
  • OF
  • p250
  • TAF(II)250
  • TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor
  • TAF1
  • TAF2A
  • TAF2AN-TAF1
  • TAFII250
  • TAFII-250
  • TAFII250DYT3
  • TBP-associated factor 250 kDa
  • transcription factor TFIID p250 polypeptide
  • Transcription initiation factor TFIID 250 kDa subunit
  • transcription initiation factor TFIID subunit 1
  • XDP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TATA binding
protein TBP Antibody
NBP3-13174
Western Blot: TATA binding protein TBP Antibody [NBP3-13174] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with TATA binding protein TBP antibody (NBP3-13174) diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: TATA binding protein TBP Antibody [NBP3-13174] - TATA binding protein TBP antibody detects TATA binding protein TBP protein at nucleus by immunohistochemical analysis. Sample: Paraffin-embedded mouse testis. TATA binding protein TBP stained by TATA binding protein TBP antibody (NBP3-13174) diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Immunohistochemistry-Paraffin: TATA binding protein TBP Antibody [NBP3-13174] - TATA binding protein TBP antibody detects TATA binding protein TBP protein at nucleus by immunohistochemical analysis. Sample: Paraffin-embedded mouse ovary. TATA binding protein TBP stained by TATA binding protein TBP antibody (NBP3-13174) diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
TAF8 Antibody
NBP2-38188
Immunocytochemistry/Immunofluorescence: TAF8 Antibody [NBP2-38188] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Western Blot: TAF8 Antibody [NBP2-38188] - Analysis in control (vector only transfected HEK293T lysate) and TAF8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: TAF8 Antibody [NBP2-38188] - Staining of human lymph node shows weak nuclear positivity in non-germinal center cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
IGFBP-rp1/IGFBP-7
Antibody [Unconjugate ...
AF1334
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human IGFBP‑rp1/IGFBP‑7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1334) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for IGFBP‑rp1/IGFBP‑7 at approximately 30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
IGFBP‑rp1/IGFBP‑7 was detected in immersion fixed paraffin-embedded sections of human pancreas using Goat Anti-Human IGFBP‑rp1/IGFBP‑7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1334) at 0.3 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to islets. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(7 Publications)
Species: Hu
Applications: IHC, WB
KAT3B/p300
Antibody (RW105) - BS
NB100-616
Immunocytochemistry/Immunofluorescence: KAT3B/p300 Antibody (RW105) [NB100-616] - HeLa cells were fixed in 4% paraformaldehyde for 10 min and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-KAT3B Antibody (RW105)) at 5ug/ml for 60 minutes at room temperature and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective.
Flow Cytometry: KAT3B/p300 Antibody (RW105) [NB100-616] - An intracellular stain was performed on Raw264.7 cells with KAT3B/p300 Antibody (RW105) NB100-616 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 1.0 ug/mL for 30 minutes at room temperature, followed by Mouse IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550 (35503, Thermo Fisher).
Immunocytochemistry/Immunofluorescence: KAT3B/p300 Antibody (RW105) [NB100-616] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-KAT3B/p300 Antibody (RW105) NB100-616 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
(9 Publications)
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, WB
KAT2A/GCN5 Antibody
NBP2-17017
Western Blot: KAT2A/GCN5 Antibody [NBP2-17017] - Sample (30 ug of whole cell lysate) A: IMR32 7. 5% SDS PAGE gel, diluted at 1:1000.
Western Blot: KAT2A/GCN5 Antibody [NBP2-17017] - Sample (30 ug of whole cell lysate) A: NIH-3T3 B: JC C: BCL-1 7. 5% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: KAT2A/GCN5 Antibody [NBP2-17017] - Analysis of paraformaldehyde-fixed MCF-7, using antibody at 1:500 dilution.
Species: Hu, Mu
Applications: ICC/IF, WB
Taf4 Antibody
NBP1-80705
Immunocytochemistry/Immunofluorescence: Taf4 Antibody [NBP1-80705] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Taf4 Antibody [NBP1-80705] - Staining of human duodenum shows moderate nuclear and cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CBP/KAT3A Antibody
NB100-381
Western Blot: CBP/KAT3A Antibody [NB100-381] - Detection of Human CBP by Western Blot. Samples: Whole cell lysate (5, 15 and 50 ug) from HeLa cells. Antibodies: Affinity purified rabbit anti-CBP antibody NB100-381 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunoprecipitation: CBP/KAT3A Antibody [NB100-381] - Whole cell lysate (1 mg for IP; 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-CBP antibody used for IP at 6 ug/mg lysate. CBP was also immunoprecipitated by rabbit anti-CBP antibody NB100-382. For blotting immunoprecipitated CBP, was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: ChIP, IP, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on A549 cells with p53 (PAb240) NB200-103AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by APC-conjugated anti-mouse IgG secondary antibody F0101B.
(3 Reviews)
(33 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
RAP74 Antibody
(OTI4B10)
NBP3-17971
Western Blot: RAP74 Antibody (OTI4B10) [NBP3-17971] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RAP74 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-RAP74.
Immunohistochemistry: RAP74 Antibody (OTI4B10) [NBP3-17971] - Staining of paraffin-embedded Carcinoma of Human bladder tissue using anti-RAP74 mouse monoclonal antibody.
Immunohistochemistry: RAP74 Antibody (OTI4B10) [NBP3-17971] - Staining of paraffin-embedded Human endometrium tissue using anti-RAP74 mouse monoclonal antibody.
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(15 Publications)
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
PCAF Antibody
(5E11)
H00008850-M04
Immunocytochemistry/Immunofluorescence: PCAF Antibody (5E11) [H00008850-M04] - Analysis of monoclonal antibody to PCAF on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: PCAF Antibody (5E11) [H00008850-M04] - Detection limit for recombinant GST tagged PCAF is approximately 0.03ng/ml as a capture antibody.
Western Blot: PCAF Antibody (5E11) [H00008850-M04] - Analysis of PCAF expression in LNCaP (Cat # L004V1).
(1 Review)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated: c-Fos Antibody (2H2) [NBP2-50037] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and c-Fox knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Mouse Anti-Human c-Fox Monoclonal Antibody (Catalog # NBP2-50037) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for c-Fox at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Section of rat hippocampus stained with mouse monoclonal antibody to c-FOS NBP2-50037 in red and counterstained with rabbit polyclonal antibody to FOX3/NeuN. DAPI reveals nuclei of neurons and glia in blue. The hippocampal neurons stain green for FOX3/NeuN and a few also are expressing c-FOS, and so appear orange. These cells were spontaneously active at the time the animal was sacrificed.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Left: NBP2-50037 staining (green) in HeLa cells, which were treated with serum-starvation for 36 hrs, followed by 2 hrs 20% FBS stimulation (bottom), or PBS treatment (top). Green c-Fos staining only localizes in the nuclei of stimulated cells, but not in un-stimulated cells. Cells are counter-stained with chicken pAb against Vimentin (NB300-223, red). Blue shows DAPI staining of nucleus. Middle: Mouse brain section (45 uM; fixed by transcardial perfusion with 4% PFA) labeled with NBP2-50037 using a standard HRP-DAB staining technique. Cells expressing c-Fos show dark color in nucleus. Right: Mouse cortical section labeled with NBP2-50037 (red) and rabbit polyclonal anti-NeuN (NBP1-92716, green) using IF confocal. Neurons positive for c-Fos and RBFOX3/NeuN appear to be yellow. Inset shows an enlarged image of NBP2-50037 staining. Nuclei are labeled with Dapi (blue).
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Cyclin D1 Antibody
(SPM587)
NBP2-32840
Western Blot: Cyclin D1 Antibody (SPM587) [NBP2-32840] - HELLS expression and protein levels are modulated with YAP1/TEAD inhibition downstream of SHH signaling. Western blot showing protein levels of HELLS, cleaved caspase 3 (CC3), and Cyclin D1 in verteporfin treated CGNPs. Blot is representative of three replicates. Full-length blots are presented in Supplementary Fig. S4. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-019-50088-1), licensed under a CC-BY licence.
Flow Cytometry: Cyclin D1 Antibody (SPM587) [NBP2-32840] - Flow Cytometric analysis of human Cyclin D1 on Jurkat cells. Black: cells alone; Green: Isotype Control; Red: PE-labeled Cyclin D1 Monoclonal Antibody (SPM587).
Flow Cytometry: Cyclin D1 Antibody (SPM587) [NBP2-32840] - Flow Cytometric analysis of human Cyclin D1 on MCF-7 cells. Black: cells alone; Green: Isotype Control; Red: PE-labeled Cyclin D1 Monoclonal Antibody (SPM587).
(1 Review)
(7 Publications)
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Dopamine D2R/DRD2
Antibody
NBP2-88996
ELISA: Dopamine D2R/DRD2 Antibody [NBP2-88996] - HEK293 cells expressing dopamine receptor (D2) were treated with indicated concentrations of agonist (Quinpirol) and antagonist (Siperone) and probed with Dopamine Receptor (D2) pAb (1:1000 of a stock solution of 1ug/uL) by cellular ELISA. Data from vehicle treated cells were taken as 100%. Results are the mean -+SEM (n=3).
Immunohistochemistry: Dopamine D2R/DRD2 Antibody [NBP2-88996] - Rat cerebral cortex. Neurons are labeled with Dopamine Receptor (D2) pAb in conjunction with Cy3 conjugated rabbit IgG antibody (H+L).
Western Blot: Dopamine D2R/DRD2 Antibody [NBP2-88996] - MW marker (1) and 10ug of rat heart membrane extract (2) probed with Dopamine Receptor (D2) pAb at 4.0ug/ml.
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
PMEL17/SILV
Antibody (OTI10E5)
NBP1-47974
Western Blot: PMEL17/SILV Antibody (10E5) [NBP1-47974] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PMEL17/SILV(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PMEL17/SILV.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-PMEL17/SILV mouse monoclonal antibody.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded breast tissue using anti-PMEL17/SILV mouse monoclonal antibody.
(1 Review)
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MCG10 Antibody
NBP1-76729
Immunocytochemistry/Immunofluorescence: MCG10 Antibody [NBP1-76729] - Hela cells.
Western Blot: MCG10 Antibody [NBP1-76729] - HeLa cell lysate with MCG10 antibody at (A) 0.5, (B) 1 and (C) 2 u/mL.
Immunocytochemistry/Immunofluorescence: MCG10 Antibody [NBP1-76729] - HeLa cells with MCG10 antibody at 1 ug/ml.
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
COCO/DAND5
Antibody (OTI2H3)
NBP2-01223
Flow Cytometry: DAND5 Antibody (2H3) [NBP2-01223] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-DAND5 antibody, and then analyzed by flow cytometry.
Western Blot: DAND5 Antibody (2H3) [NBP2-01223] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY DAND5 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-DAND5.
Immunohistochemistry-Paraffin: DAND5 Antibody (2H3) [NBP2-01223] - Staining of paraffin-embedded Adenocarcinoma of Human breast tissue using anti-DAND5 mouse monoclonal antibody.
Species: Hu
Applications: Flow, IHC, IHC-P, WB
TAF7 Antibody (2C5)
H00006879-M01
Immunocytochemistry/Immunofluorescence: TAF7 Antibody (2C5) [H00006879-M01] - Analysis of monoclonal antibody to TAF7 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: TAF7 Antibody (2C5) [H00006879-M01] - Analysis of monoclonal antibody to TAF7 on formalin-fixed paraffin-embedded human lymph node. Antibody concentration 3 ug/ml.
Immunohistochemistry-Paraffin: TAF7 Antibody (2C5) [H00006879-M01] - Analysis of monoclonal antibody to TAF7 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 1 ug/ml.
(5 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
SP1 Antibody
NB600-232
Western Blot: SP1 Antibody [NB600-232] - A. Whole cell lysate (50 ug for E; 10 ug for T) from HEK 293T cells that were mock transfected (E) or transfected with an Sp1 expression construct (T). B. Whole cell lysate (~700 ug) from HEK 293T cells. A. Affinity purified rabbit anti-Sp1 antibody used at the indicated concentrations. B. SP1 was immunoprecipitated using affinity purified rabbit anti-SP1 antibodies BL937, using each antibody at 3.75 ug/mg lysate. Subsequently, was used at 0.04 ug/mL for WB. Detection by chemiluminescence with an exposure time of 10 seconds (A) or 1 min (B).
Immunohistochemistry-Paraffin: SP1 Antibody [NB600-232] - FFPE sections of human breast carcinoma (left) and mouse squamous cell carcinoma (right). Affinity purified rabbit anti-Sp1 used at a dilution of 1:1,000 (1 ug/mL). Detection by DAB.
Western Blot: SP1 Antibody [NB600-232] - Detection of Human SP1 by Western Blot. Whole cell lysate (50 ug) from HeLa and 293T cells prepared using NETN lysis buffer. Affinity purified rabbit anti-SP1 antibody (NB600-232) used for WB at 0.04 ug/mL. Detection by chemiluminescence with an exposure time of 3 minutes.
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
KAT4/TBP
Associated Factor 1 A
NBP3-10940
KAT4/TBP Associated Factor 1 Antibody
Species: Hu, Mu
Applications: WB, ChIP, IHC

Publications for KAT4/TBP Associated Factor 1 Antibody (NBP3-10940) (0)

There are no publications for KAT4/TBP Associated Factor 1 Antibody (NBP3-10940).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KAT4/TBP Associated Factor 1 Antibody (NBP3-10940) (0)

There are no reviews for KAT4/TBP Associated Factor 1 Antibody (NBP3-10940). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ChIP Video Protocol
ChIP Webinar

FAQs for KAT4/TBP Associated Factor 1 Antibody (NBP3-10940) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KAT4/TBP Associated Factor 1 Products

Bioinformatics Tool for KAT4/TBP Associated Factor 1 Antibody (NBP3-10940)

Discover related pathways, diseases and genes to KAT4/TBP Associated Factor 1 Antibody (NBP3-10940). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KAT4/TBP Associated Factor 1 Antibody (NBP3-10940)

Discover more about diseases related to KAT4/TBP Associated Factor 1 Antibody (NBP3-10940).
 

Pathways for KAT4/TBP Associated Factor 1 Antibody (NBP3-10940)

View related products by pathway.

PTMs for KAT4/TBP Associated Factor 1 Antibody (NBP3-10940)

Learn more about PTMs related to KAT4/TBP Associated Factor 1 Antibody (NBP3-10940).
 

Research Areas for KAT4/TBP Associated Factor 1 Antibody (NBP3-10940)

Find related products by research area.

Blogs on KAT4/TBP Associated Factor 1

There are no specific blogs for KAT4/TBP Associated Factor 1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KAT4/TBP Associated Factor 1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TAF1