Kallikrein 4/Prostase/EMSP1 Antibody (2A4) - Azide and BSA Free Summary
Immunogen |
KLK4 (NP_004908.2, 159 a.a. ~ 254 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GRMPTVLQCVNVSVVSEEVCSKLYDPLYHPSMFCAGGGQDQKDSCNGDSGGPLICNGYLQGLVSFGKAPCGQVGVPGVYTNLCKFTEWIEKTVQAS |
Specificity |
KLK4 - kallikrein 4 (prostase, enamel matrix, prostate) (2A4) |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
KLK4 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot 1:500
|
Application Notes |
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
Publications |
|
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Kallikrein 4/Prostase/EMSP1 Antibody (2A4) - Azide and BSA Free
Background
Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. In some tissues its expression is hormonally regulated. The expression pattern of a similar mouse protein in murine developing teeth supports a role for the protein in the degradation of enamel proteins. Alternate splice variants for this gene have been described, but their biological validity has not been determined. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IP, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: WB, ELISA
Publications for Kallikrein 4/Prostase/EMSP1 Antibody (H00009622-M09)(1)
Showing Publication 1 -
1 of 1.
Publication using H00009622-M09 |
Applications |
Species |
Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018-01-01 |
|
|
Reviews for Kallikrein 4/Prostase/EMSP1 Antibody (H00009622-M09) (0)
There are no reviews for Kallikrein 4/Prostase/EMSP1 Antibody (H00009622-M09).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Kallikrein 4/Prostase/EMSP1 Antibody (H00009622-M09) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Kallikrein 4/Prostase/EMSP1 Products
Research Areas for Kallikrein 4/Prostase/EMSP1 Antibody (H00009622-M09)
Find related products by research area.
|
Blogs on Kallikrein 4/Prostase/EMSP1