JTB Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse JTB Antibody - Azide and BSA Free (H00010899-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
JTB (AAH00996, 1 a.a. - 146 a.a.) full-length human protein. MLAGAGRPGLPQGRHLCWLLCAFTLKLCQAEAPVQEEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRLFWKFEGAVVCVALIFACLVIIRQRQLDRKALEKVRKQIESI |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
JTB |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This antibody is useful for Western Blot, Functional |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for JTB Antibody - Azide and BSA Free
Background
JTB, also known as Protein JTB, has a 146 amino acid long isoform that is 16 kDa and a short 117 amino acid that is 13 kDa; needed for normal cytokinesis during mitosis, participates in the regulation of cell proliferation, may be a component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly, fosters AURKB activity, its overexpression induces swelling of mitochondria and reduces mitochondrial membrane potential. Disease research is currently being studied with relation to JTB and lymph node tuberculosis, tuberculous meningitis, abdominal tuberculosis, prostatitis, hepatocellular carcinoma, carcinoma, and adenoid cystic carcinoma. The protein has been shown to interact with AURKA, AURKB, BIRC5, INCENP, and LIG3 proteins in apoptotic process, regulation of cell proliferation, cell cycle cytokinesis, mitosis, and cell cycle pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
Species: Hu
Applications: DirELISA, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ICC, IHC, IHC-P, WB (-)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu
Applications: IHC
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: WB
Publications for JTB Antibody (H00010899-B01P) (0)
There are no publications for JTB Antibody (H00010899-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for JTB Antibody (H00010899-B01P) (0)
There are no reviews for JTB Antibody (H00010899-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for JTB Antibody (H00010899-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional JTB Products
Research Areas for JTB Antibody (H00010899-B01P)
Find related products by research area.
|
Blogs on JTB