JTB Antibody

Images

 
Western Blot: JTB Antibody [H00010899-B01P] - Analysis of JTB expression in transfected 293T cell line by JTB polyclonal antibody. Lane 1: JTB transfected lysate(16.17 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

JTB Antibody Summary

Immunogen
JTB (AAH00996, 1 a.a. - 146 a.a.) full-length human protein. MLAGAGRPGLPQGRHLCWLLCAFTLKLCQAEAPVQEEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRLFWKFEGAVVCVALIFACLVIIRQRQLDRKALEKVRKQIESI
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
JTB
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is useful for Western Blot, Functional

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for JTB Antibody

  • Gm622
  • hJT
  • HJTB
  • HSPC222
  • JTB
  • Jumping translocation breakpoint protein
  • jumping translocation breakpoint
  • PAR Protein
  • PAR
  • Prostate androgen-regulated protein
  • protein JTB

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
H00002011-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-87338
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB3949
Species: Hu
Applications: CyTOF-ready, Flow
NBP2-49382
Species: Hu
Applications: IHC, IHC-P
NB500-526
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP2-43728
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
210-TA
Species: Hu
Applications: BA
NBP1-88861
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
AF3844
Species: Hu, Mu
Applications: IHC
H00055065-P01
Species: Hu
Applications: ELISA, AP, PA, WB
DY413
Species: Mu
Applications: ELISA
NBP3-03965
Species: Hu, Mu, Rt
Applications: ICC/IF, WB

Publications for JTB Antibody (H00010899-B01P) (0)

There are no publications for JTB Antibody (H00010899-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JTB Antibody (H00010899-B01P) (0)

There are no reviews for JTB Antibody (H00010899-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for JTB Antibody (H00010899-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional JTB Products

Array H00010899-B01P

Bioinformatics Tool for JTB Antibody (H00010899-B01P)

Discover related pathways, diseases and genes to JTB Antibody (H00010899-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for JTB Antibody (H00010899-B01P)

Discover more about diseases related to JTB Antibody (H00010899-B01P).
 

Pathways for JTB Antibody (H00010899-B01P)

View related products by pathway.

PTMs for JTB Antibody (H00010899-B01P)

Learn more about PTMs related to JTB Antibody (H00010899-B01P).
 

Research Areas for JTB Antibody (H00010899-B01P)

Find related products by research area.

Blogs on JTB

There are no specific blogs for JTB, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our JTB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol JTB
Uniprot