Jarid1A Antibody (5B10P1)

Western Blot: Jarid1A Antibody (5B10P1) [NBP3-16478] - Analysis of extracts of Mouse lung, using Jarid1A Rabbit mAb (NBP3-16478) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.

Western Blot: Jarid1A Antibody (5B10P1) [NBP3-16478] - Analysis of extracts of various cell lines, using Jarid1A Rabbit mAb (NBP3-16478) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Immunoprecipitation: Jarid1A Antibody (5B10P1) [NBP3-16478] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug Jarid1A antibody (NBP3-16478). Western blot was performed from the immunoprecipitate using Jarid1A antibody (NBP3-16478) at a dilition of 1:500.

Chromatin Immunoprecipitation: Jarid1A Antibody (5B10P1) [NBP3-16478] - Analysis of extracts of HCT116 cells, using KDM5A antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Chromatin Immunoprecipitation: Jarid1A Antibody (5B10P1) [NBP3-16478] - Chromatin immunoprecipitation analysis of extracts of HCT116 cells, using Jarid1A antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Chromatin Immunoprecipitation: Jarid1A Antibody (5B10P1) [Jarid1A] - Chromatin immunoprecipitation analysis of extracts of HCT116 cells, using Jarid1A antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IP, ChIP
• Clone: 5B10P1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Jarid1A Antibody (5B10P1) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1400-1690 of human Jarid1A (P29375). HAYSSASKSCSQGSSTPRKQPRKSPLVPRSLEPPVLELSPGAKAQLEELMMVGDLLEVSLDETQHIWRILQATHPPSEDRFLHIMEDDSMEEKPLKVKGKDSSEKKRKRKLEKVEQLFGEGKQKSKELKKMDKPRKKKLKLGADKSKELNKLAKKLAKEEERKKKKEKAAAAKVELVKESTEKKREKKVLDIPSKYDWSGAEESDDENAVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCAKKQGPVSPGPAPPPSFIMSYKLPMEDLKETS
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: KDM5A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation (ChIP) 10ug-15ug of Chromatin
  • ELISA
  • Immunoprecipitation -0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 192 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Jarid1A Antibody (5B10P1)

• EC 1.14.11
• EC 1.14.11.-
• EC 1.14.11.67
• Histone demethylase JARID1A
• Jarid1A
• JARID1AJumonji, AT rich interactive domain 1A (RBP2-like)
• Jumonji, AT rich interactive domain 1A (RBBP2-like)
• Jumonji/ARID domain-containing protein 1A
• KDM5A
• lysine (K)-specific demethylase 5A
• RBBP2
• RBBP-2
• RBBP2lysine-specific demethylase 5A
• RBP2
• RBP2retinoblastoma binding protein 2
• Retinoblastoma-binding protein 2jumonji, AT rich interactive domain 1A

Background

Jarid1A is encoded by this gene is a ubiquitously expressed nuclear protein. It binds directly, with several other proteins, to retinoblastoma protein which regulates cell proliferation. This protein also interacts with rhombotin-2 which functions distinctly in erythropoiesis and in T-cell leukemogenesis. Rhombotin-2 is thought to either directly affect the activity of the encoded protein or may indirectly modulate the functions of the retinoblastoma protein by binding to this protein. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KDM5A