JAKMIP2 Antibody


Immunohistochemistry: JAKMIP2 Antibody [NBP2-47414] - Staining of human cerebral cortex shows moderate positivity in neuropil, endothelial cells were distinctly stained.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

JAKMIP2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: KLQVIEQQNIIDELTRDREKLIRRRKHRRSSKPIKRPVLDPFIGYDEDSMDSETSSMASFRTDRT
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
JAKMIP2 Protein (NBP2-47414PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for JAKMIP2 Antibody

  • CTCL tumor antigen HD-CL-04
  • JAMIP2KIAA0555Jak and microtubule interacting protein 2
  • janus kinase and microtubule interacting protein 2
  • janus kinase and microtubule-interacting protein 2
  • NECC1
  • neuroendocrine long coiled-coil 1
  • Neuroendocrine long coiled-coil protein 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Bv, Ca, Ch, Gp, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt, Sh, Xp
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: IP, WB
Species: Ch, Hu, Mu, Rt
Applications: ICC, IHC
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for JAKMIP2 Antibody (NBP2-47414) (0)

There are no publications for JAKMIP2 Antibody (NBP2-47414).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JAKMIP2 Antibody (NBP2-47414) (0)

There are no reviews for JAKMIP2 Antibody (NBP2-47414). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for JAKMIP2 Antibody (NBP2-47414) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional JAKMIP2 Products

Bioinformatics Tool for JAKMIP2 Antibody (NBP2-47414)

Discover related pathways, diseases and genes to JAKMIP2 Antibody (NBP2-47414). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for JAKMIP2 Antibody (NBP2-47414)

Discover more about diseases related to JAKMIP2 Antibody (NBP2-47414).

Research Areas for JAKMIP2 Antibody (NBP2-47414)

Find related products by research area.

Blogs on JAKMIP2

There are no specific blogs for JAKMIP2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our JAKMIP2 Antibody and receive a gift card or discount.


Gene Symbol JAKMIP2