JAKMIP2 Antibody - BSA Free

Immunohistochemistry: JAKMIP2 Antibody [NBP2-47414] - Staining of human cerebral cortex shows moderate positivity in neuropil, endothelial cells were distinctly stained.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

JAKMIP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit JAKMIP2 Antibody - BSA Free (NBP2-47414) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KLQVIEQQNIIDELTRDREKLIRRRKHRRSSKPIKRPVLDPFIGYDEDSMDSETSSMASFRTDRT
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: JAKMIP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  JAKMIP2 Protein (NBP2-47414PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for JAKMIP2 Antibody - BSA Free

• CTCL tumor antigen HD-CL-04
• JAMIP2KIAA0555Jak and microtubule interacting protein 2
• janus kinase and microtubule interacting protein 2
• janus kinase and microtubule-interacting protein 2
• NECC1
• neuroendocrine long coiled-coil 1
• Neuroendocrine long coiled-coil protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: JAKMIP2