Jak2 Recombinant Protein Antigen

Images

 
There are currently no images for Jak2 Protein (NBP2-38476PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Jak2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human JAK2.

Source: E. coli

Amino Acid Sequence: VPVTHETQEECLGMAVLDMMRIAKENDQTPLAIYNSISYKTFLPKCIRAKIQDYHILTRKRIRYRFRRFIQQFSQCKATARNLKLKYLINLETLQSAFYTEKFEVKEPGSGPSGEEIFATIIITGNGGIQWSR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
JAK2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38476.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Jak2 Recombinant Protein Antigen

  • EC 2.7.10
  • EC 2.7.10.2
  • Jak2
  • JAK-2
  • Janus kinase 2Janus kinase 2 (a protein tyrosine kinase)
  • JTK10
  • tyrosine-protein kinase JAK2

Background

Jak2 is a member of the Janus family tyrosine kinases (Jaks), whose function is to transduce extracellular signals from cytokines and interferons. Jaks associate with cytokine receptors; upon ligand binding, Jaks phosphorylate the receptor. The phosphorylated receptors are bound by SH2-containing proteins, one class of which is the signal transducers and activators of transcription (STATs). Activated STATs, then, translocate to the nucleus to mediate gene transcription (1,2). Tyr1007/1008 of Jak2 are the homologous Tyr1054/1055 in Tyk2, and phosphorylation at these residues is needed for Tyk2 activation (3). A chromosomal aberration involving Jak2 is found in a form of pre-B acute myeloid leukemia (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
MAB4260
Species: Hu, Mu, Rt
Applications: Simple Western, WB
AF2168
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
AF1584
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
MEP00B
Species: Mu
Applications: ELISA
NB400-141
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
AF2894
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF1360
Species: Mu
Applications: IHC, WB
NBP2-37737
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, WB
203-IL
Species: Hu
Applications: BA
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
AF1016
Species: Hu
Applications: Neut, Simple Western, WB
MAB3427
Species: Hu
Applications: WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
DTM100
Species: Hu
Applications: ELISA
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB

Publications for Jak2 Protein (NBP2-38476PEP) (0)

There are no publications for Jak2 Protein (NBP2-38476PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Jak2 Protein (NBP2-38476PEP) (0)

There are no reviews for Jak2 Protein (NBP2-38476PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Jak2 Protein (NBP2-38476PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Jak2 Products

Array NBP2-38476PEP

Research Areas for Jak2 Protein (NBP2-38476PEP)

Find related products by research area.

Blogs on Jak2.

Signal Transducer and Activator of Transcription STAT6: More than a Player in Allergic Inflammation
By Jamshed Arslan, Pharm. D., PhD. What is STAT6?The cellular pathway comprising tyrosine kinase Janus Kinase (JAK) and the transcription factor STAT connect extracellular signals from various cytokines, hormones an...  Read full blog post.

Using a STAT3 antibody in chromatin immunoprecipitation (ChIP)
Signal transducer and activator of transcription 3 (STAT3) is an important oncogenic transcriptional factor that mediates tumor induced immune suppression.  Specifically, STAT3 transmits signals from cytokines and growth factor receptors in the pla...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Jak2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol JAK2