Jagged 2 Antibody


Immunohistochemistry-Paraffin: Jagged 2 Antibody [NBP1-86337] - Staining of human cervix, uterine shows moderate membranous positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Jagged 2 Antibody [NBP1-86337] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Jagged 2 Antibody [NBP1-86337] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: Jagged 2 Antibody [NBP1-86337] - Staining of human skeletal muscle shows no positivity as expected.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-Fr, IHC-P

Order Details

Jagged 2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDENYYS
Specificity of human, mouse Jagged 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunohistochemistry-Frozen reported in scientific literature (PMID 27183608).
Control Peptide
Jagged 2 Recombinant Protein Antigen (NBP1-86337PEP)
Read Publication using
NBP1-86337 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27183608).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Jagged 2 Antibody

  • HJ2
  • JAG2
  • Jagged 2
  • Jagged2
  • protein jagged-2
  • SER2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
Species: Hu, Mu, Pm
Applications: WB, IHC-P
Species: Hu, Rb
Applications: WB, Flow, IHC-P
Species: Hu
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P

Publications for Jagged 2 Antibody (NBP1-86337)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC-Fr.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for Jagged 2 Antibody (NBP1-86337) (0)

There are no reviews for Jagged 2 Antibody (NBP1-86337). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Jagged 2 Antibody (NBP1-86337) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Jagged 2 Antibody (NBP1-86337)

Discover related pathways, diseases and genes to Jagged 2 Antibody (NBP1-86337). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Jagged 2 Antibody (NBP1-86337)

Discover more about diseases related to Jagged 2 Antibody (NBP1-86337).

Pathways for Jagged 2 Antibody (NBP1-86337)

View related products by pathway.

PTMs for Jagged 2 Antibody (NBP1-86337)

Learn more about PTMs related to Jagged 2 Antibody (NBP1-86337).

Blogs on Jagged 2.

Notch Antibody Proves Metastatic Lung Cancer Has a Jagged Edge
We at Novus Biologicals are one of the leading antibody suppliers for cancer research. In a recent Notch antibody study, the Notch ligand Jagged 2 was found to promote the growth of metastatic lung cancer cells by inhibiting miR-200, which blocks epit...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Jagged 2 Antibody and receive a gift card or discount.


Gene Symbol JAG2