JAB1 Antibody

Images

 
Western Blot: JAB1 Antibody [NBP1-84370] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: JAB1 Antibody [NBP1-84370] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: JAB1 Antibody [NBP1-84370] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous tubules.
Western Blot: JAB1 Antibody [NBP1-84370] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

JAB1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COPS5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
JAB1 Protein (NBP1-84370PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for JAB1 Antibody

  • COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis)
  • COP9 signalosome complex subunit 5
  • COPS5
  • CSN5
  • CSN5COP9 (constitutive photomorphogenic, Arabidopsis, homolog) subunit 5
  • EC 3.4
  • JAB1
  • JAB138 kDa Mov34 homolog
  • Jun activation domain-binding protein 1
  • MOV-34
  • SGN5
  • SGN5MGC3149
  • Signalosome subunit 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-84407
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1555
Species: Hu
Applications: WB
NBP2-15141
Species: Hu
Applications: WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7557
Species: Hu
Applications: WB, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP2-37523
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
AF6817
Species: Hu
Applications: WB

Publications for JAB1 Antibody (NBP1-84370) (0)

There are no publications for JAB1 Antibody (NBP1-84370).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JAB1 Antibody (NBP1-84370) (0)

There are no reviews for JAB1 Antibody (NBP1-84370). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for JAB1 Antibody (NBP1-84370) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional JAB1 Products

Bioinformatics Tool for JAB1 Antibody (NBP1-84370)

Discover related pathways, diseases and genes to JAB1 Antibody (NBP1-84370). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for JAB1 Antibody (NBP1-84370)

Discover more about diseases related to JAB1 Antibody (NBP1-84370).
 

Pathways for JAB1 Antibody (NBP1-84370)

View related products by pathway.

PTMs for JAB1 Antibody (NBP1-84370)

Learn more about PTMs related to JAB1 Antibody (NBP1-84370).

Blogs on JAB1

There are no specific blogs for JAB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our JAB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COPS5
Entrez