IVD Antibody

Images

 
Western Blot: IVD Antibody [NBP2-30578] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: IVD Antibody [NBP2-30578] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: IVD Antibody [NBP2-30578] - Staining of human liver shows strong cytoplasmic positivity(granular pattern) in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IVD Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LLPVDDAINGLSEEQRQLRQTMAKFLQEHLAPKAQEIDRSNEFKNLREFWKQLGNLGVLGITAPVQYGGSGLGYLEHVLVMEEISRASGAVGLSYGAHSNLCINQLVRNGNE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IVD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IVD Protein (NBP2-30578PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IVD Antibody

  • ACAD2
  • EC 1.3.99
  • EC 1.3.99.10
  • FLJ12715
  • FLJ34849
  • isovaleryl-CoA dehydrogenase
  • mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF5540
Species: Mu
Applications: WB
NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00000034-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
NBP2-55789
Species: Hu
Applications: WB, ICC/IF
AF4096
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
MAB2476
Species: Hu
Applications: WB, IHC
NBP2-30578
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for IVD Antibody (NBP2-30578) (0)

There are no publications for IVD Antibody (NBP2-30578).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IVD Antibody (NBP2-30578) (0)

There are no reviews for IVD Antibody (NBP2-30578). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IVD Antibody (NBP2-30578) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IVD Products

Bioinformatics Tool for IVD Antibody (NBP2-30578)

Discover related pathways, diseases and genes to IVD Antibody (NBP2-30578). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IVD Antibody (NBP2-30578)

Discover more about diseases related to IVD Antibody (NBP2-30578).
 

Pathways for IVD Antibody (NBP2-30578)

View related products by pathway.

PTMs for IVD Antibody (NBP2-30578)

Learn more about PTMs related to IVD Antibody (NBP2-30578).
 

Research Areas for IVD Antibody (NBP2-30578)

Find related products by research area.

Blogs on IVD

There are no specific blogs for IVD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IVD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IVD
Uniprot