ITPKA Antibody

Western Blot: ITPKA Antibody [NBP1-81590] - Analysis in human cerebral cortex tissue.

Immunocytochemistry/Immunofluorescence: ITPKA Antibody [NBP1-81590] - Staining of human cell line U-251 MG shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ITPKA Antibody [NBP1-81590] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry: ITPKA Antibody [NBP1-81590] - Staining of mouse hippocampus shows positivity in astrocytes.

Immunohistochemistry: ITPKA Antibody [NBP1-81590] - Staining of mouse hypothalamus shows positivity in astrocyte end feet accentuated around blood vessels.

Immunohistochemistry: ITPKA Antibody [NBP1-81590] - Staining of mouse subiculum shows immunoreactivity in astrocytes.

Immunohistochemistry-Paraffin: ITPKA Antibody [NBP1-81590] - Staining of human caudate shows strong positivity in astrocytes.

Immunohistochemistry-Paraffin: ITPKA Antibody [NBP1-81590] - Staining of human cerebral cortex shows moderate positivity in astrocytes.

Immunohistochemistry-Paraffin: ITPKA Antibody [NBP1-81590] - Staining of human glioma shows strong cytoplasmic positivity in tumor cells.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ITPKA Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DGSCSTDFKTTRSREQVLRVFEEFVQGDEEVLRRYLNRLQQIRDTLEVSEFFRRHEV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ITPKA
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ITPKA Protein (NBP1-81590PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ITPKA Antibody

• EC 2.7.1.127
• inositol 14,5-trisphosphate 3-kinase AIP3 3-kinase A
• inositol-trisphosphate 3-kinase A
• InsP 3-kinase A
• IP3-3KA
• IP3K A
• IP3KA

Background

Regulates inositol phosphate metabolism by phosphorylation of second messenger inositol 1,4,5-trisphosphate to Ins(1,3,4,5)P4. The activity of the inositol 1,4,5-trisphosphate 3-kinase is responsible for regulating the levels of a large number of inositol polyphosphates that are important in cellular signaling. Both calcium/calmodulin and protein phosphorylation mechanisms control its activity. It is also a substrate for the cyclic AMP-dependent protein kinase, calcium/calmodulin- dependent protein kinase II, and protein kinase C in vitro. ITPKA and ITPKB are 68% identical in the C-terminus region. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ITPKA