PNCK Antibody

Immunocytochemistry/Immunofluorescence: PNCK Antibody [NBP1-86652] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.

Immunohistochemistry-Paraffin: PNCK Antibody [NBP1-86652] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: PNCK Antibody [NBP1-86652] - Staining of human cerebral cortex shows moderate positivity in neurons and neuropil.

Immunohistochemistry-Paraffin: PNCK Antibody [NBP1-86652] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: PNCK Antibody [NBP1-86652] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PNCK Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MLLLKKHTEDISSVYEIRERLGSGAFSEVVLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRISHPN
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PNCK
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PNCK Protein (NBP1-86652PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PNCK Antibody

• BSTK3
• calcium/calmodulin-dependent protein kinase type 1B
• CaM kinase I beta
• CaM kinase IB
• CaMK1b
• CaM-KI beta
• caMKI-beta
• EC 2.7.11
• EC 2.7.11.17
• FLJ50403
• FLJ50549
• FLJ56451
• FLJ59811
• MGC45419
• pregnancy up-regulated non-ubiquitously expressed CaM kinase
• pregnancy upregulated non-ubiquitously expressed CaM kinase
• Pregnancy up-regulated non-ubiquitously-expressed CaM kinase

Background

PNCK is a member of the calcium/calmodulin-dependent protein kinase family of protein serine/threonine kinases (see CAMK1; MIM 604998) (Gardner et al., 2000 [PubMed 10673339]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PNCK