IP3KC Antibody

Images

 
Western Blot: IP3KC Antibody [NBP2-49068] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: IP3KC Antibody [NBP2-49068] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.
Immunohistochemistry: IP3KC Antibody [NBP2-49068] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IP3KC Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QIQQDTDGSWTQPSTDGSQTAPGTDCLLGEPEDGPLEEPEPGELLTHLYSHLKCSPLCPVPRLIITPETPEPEAQPVGPPSRVEGGSGGFSSASSFDESE
Specificity
Specificity of human IP3KC antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITPKC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IP3KC Recombinant Protein Antigen (NBP2-49068PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IP3KC Antibody

  • inositol 14,5-trisphosphate 3-kinase CIP3K C
  • inositol-trisphosphate 3-kinase C
  • InsP 3 kinase C
  • InsP 3-kinase C
  • IP3 3-kinase C
  • IP3-3KC
  • IP3KCEC 2.7.1.127

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP1-81589
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-75522
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-65538
Species: Hu
NBP1-81590
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NBP1-86665
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89426
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1330
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready, ICC
AF2050
Species: Hu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-75618
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00201780-P01
Species: Hu
NBP1-85010
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85792
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49068
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for IP3KC Antibody (NBP2-49068) (0)

There are no publications for IP3KC Antibody (NBP2-49068).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IP3KC Antibody (NBP2-49068) (0)

There are no reviews for IP3KC Antibody (NBP2-49068). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IP3KC Antibody (NBP2-49068) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for IP3KC Antibody (NBP2-49068)

Discover related pathways, diseases and genes to IP3KC Antibody (NBP2-49068). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IP3KC Antibody (NBP2-49068)

Discover more about diseases related to IP3KC Antibody (NBP2-49068).
 

Pathways for IP3KC Antibody (NBP2-49068)

View related products by pathway.

PTMs for IP3KC Antibody (NBP2-49068)

Learn more about PTMs related to IP3KC Antibody (NBP2-49068).

Blogs on IP3KC

There are no specific blogs for IP3KC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IP3KC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITPKC