ITM2A Antibody

Western Blot: ITM2A Antibody [NBP2-84100] - Host: Rabbit. Target Name: ITM2A. Sample Tissue: Human 293T Whole Cell. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ITM2A Antibody Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ITM2A. Peptide sequence: LGLSFILAGLIVGGACIYKYFMPKSTIYRGEMCFFDSEDPANSLRGGEPN The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ITM2A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ITM2A Antibody

• BRICD2A
• BRICHOS domain containing 2A
• E25A
• E25ABRICD2A
• integral membrane protein 2A
• ITM2A
• Protein E25

Background

ITM2A( AAH40437, 1 a.a. - 264 a.a.) full-length recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ITM2A