ITIH1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: QPGDYFDLVLFGTRVQSWKGSLVQASEANLQAAQDFVRGFSLDEATNLNGGLLRGIEILNQVQESLPELSNHA |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ITIH1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for ITIH1 Antibody - BSA Free
Background
The protein encoded by the ITIH1 gene is the heavy chain of a serine protease inhibitor that may serve to carry hyaluronanin plasma. This gene is part of a cluster of similar genes on chromosome 3. Multiple transcript variants encodingdifferent isoforms have been found for this gene. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
Species: Mu
Applications: IP, Neut, WB
Species: Hu
Applications: Flow-CS, Flow-IC, Flow, IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P, WB
Species: Hu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB
Species: Mu
Applications: IP, Neut, WB
Species: Hu
Applications: IHC
Publications for ITIH1 Antibody (NBP1-81783) (0)
There are no publications for ITIH1 Antibody (NBP1-81783).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ITIH1 Antibody (NBP1-81783) (0)
There are no reviews for ITIH1 Antibody (NBP1-81783).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for ITIH1 Antibody (NBP1-81783) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ITIH1 Products
Research Areas for ITIH1 Antibody (NBP1-81783)
Find related products by research area.
|
Blogs on ITIH1