ITGB1BP3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ITGB1BP3 Antibody [NBP2-55685] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm & vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ITGB1BP3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VYLDGMKSREELFREVLEDIQNSLLNRSQESAPSPARPARTQGPGRGCGHRTARPAASQQDSM
Specificity
Specificity of human ITGB1BP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NMRK2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ITGB1BP3 Recombinant Protein Antigen (NBP2-55685PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ITGB1BP3 Antibody

  • EC 2.7.1.22
  • EC 2.7.1.n4
  • integrin beta 1 binding protein 3
  • Integrin beta-1-binding protein 3
  • MGC126624
  • MIBPNRK 2
  • Muscle integrin-binding protein
  • muscle-specific beta 1 integrin binding protein
  • nicotinamide riboside kinase 2
  • Nicotinic acid riboside kinase 2
  • NmR-K 2
  • NRK2RNK 2
  • Ribosylnicotinamide kinase 2
  • Ribosylnicotinic acid kinase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-79662
Species: Hu
Applications: WB
NBP2-93525
Species: Hu, Rt
Applications: WB, ICC/IF
AF2560
Species: Hu
Applications: WB
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Gp, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-84121
Species: Hu
Applications: IHC, IHC-P
NBP2-72961
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-31180
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24459
Species: Hu, Mu, Rt, Ca, Ch, Pm, Rb, RM, Xp, Ze
Applications: WB, ICC/IF
NBP2-36561
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, B/N
NBP1-88573
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74460
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, KO
NBP2-20261
Species: Hu
Applications: WB, ICC/IF
NBP1-81516
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB4027
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-52030
Species: Hu
Applications: WB, PEP-ELISA
AF3937
Species: Hu
Applications: WB, Simple Western, IHC
NB100-64808
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IP, IF

Publications for ITGB1BP3 Antibody (NBP2-55685) (0)

There are no publications for ITGB1BP3 Antibody (NBP2-55685).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ITGB1BP3 Antibody (NBP2-55685) (0)

There are no reviews for ITGB1BP3 Antibody (NBP2-55685). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ITGB1BP3 Antibody (NBP2-55685) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ITGB1BP3 Products

Bioinformatics Tool for ITGB1BP3 Antibody (NBP2-55685)

Discover related pathways, diseases and genes to ITGB1BP3 Antibody (NBP2-55685). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ITGB1BP3 Antibody (NBP2-55685)

Discover more about diseases related to ITGB1BP3 Antibody (NBP2-55685).
 

Pathways for ITGB1BP3 Antibody (NBP2-55685)

View related products by pathway.

Research Areas for ITGB1BP3 Antibody (NBP2-55685)

Find related products by research area.

Blogs on ITGB1BP3

There are no specific blogs for ITGB1BP3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ITGB1BP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NMRK2