NRK1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NRK1 Antibody [NBP2-14426] - Staining of human cell line A-431 shows positivity in cytoplasm & nucleus but excluded from the nucleoli. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: NRK1 Antibody [NBP2-14426] - Staining of human small intestine shows distinct cytoplasmic and membranous positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NRK1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NRK1 Antibody - BSA Free (NBP2-14426) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: DDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NMRK1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NRK1 Recombinant Protein Antigen (NBP2-14426PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NRK1 Antibody - BSA Free

• bA235O14.2
• C9orf95
• cDNA FLJ39825
• EC 2.7.1.173
• EC 2.7.1.22
• EC 2.7.1.n4
• FLJ20559
• nicotinamide riboside kinase 1
• Nicotinic acid riboside kinase 1
• NmR-K 1
• NMRK1
• NRK 1
• NRK1
• Ribosylnicotinamide kinase 1
• Ribosylnicotinic acid kinase 1
• RNK 1

Background

Nicotinamide adenine dinucleotide (NAD+) is essential for life in all organisms, both as a coenzyme for oxidoreductases and as a source of ADP-ribosyl groups used in various reactions. Nicotinic acid and nicotinamide, collectively known as niacin, are the vitamin precursors of NAD+. Nicotinamide riboside kinases, such as NRK1, function to synthesize NAD+ through nicotinamide mononucleotide using nicotinamide riboside as the precursor (Bieganowski and Brenner, 2004 [PubMed 15137942]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NMRK1