NRK1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NRK1 Antibody [NBP2-14426] - Staining of human cell line A-431 shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
Immunohistochemistry-Paraffin: NRK1 Antibody [NBP2-14426] - Staining of human small intestine shows distinct cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NRK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTD QESAEEIPILIIEGFLLFNYKPLDTIWNRS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NMRK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NRK1 Protein (NBP2-14426PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NRK1 Antibody

  • bA235O14.2
  • chromosome 9 open reading frame 95
  • EC 2.7.1.22
  • EC 2.7.1.n4
  • FLJ20559
  • nicotinamide riboside kinase 1
  • Nicotinic acid riboside kinase 1
  • NmR-K 1
  • NRK 1
  • NRK1
  • Ribosylnicotinamide kinase 1
  • Ribosylnicotinic acid kinase 1
  • RNK 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84121
Species: Hu
Applications: IHC, IHC-P
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55685
Species: Hu
Applications: ICC/IF
NB100-56139
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-42686
Species: Hu
Applications: WB (-), IHC, IP
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-43639
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB1774
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-13323
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-402
Species: Hu, Mu, Rt, Po, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for NRK1 Antibody (NBP2-14426) (0)

There are no publications for NRK1 Antibody (NBP2-14426).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NRK1 Antibody (NBP2-14426) (0)

There are no reviews for NRK1 Antibody (NBP2-14426). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NRK1 Antibody (NBP2-14426) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NRK1 Products

Bioinformatics Tool for NRK1 Antibody (NBP2-14426)

Discover related pathways, diseases and genes to NRK1 Antibody (NBP2-14426). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NRK1 Antibody (NBP2-14426)

Discover more about diseases related to NRK1 Antibody (NBP2-14426).
 

Pathways for NRK1 Antibody (NBP2-14426)

View related products by pathway.

Blogs on NRK1

There are no specific blogs for NRK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NRK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NMRK1