Reactivity | HuSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEV |
Specificity | Specificity of human RABL4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | IFT27 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for RABL4 Antibody (NBP1-87170)Discover more about diseases related to RABL4 Antibody (NBP1-87170).
| Pathways for RABL4 Antibody (NBP1-87170)View related products by pathway.
|
PTMs for RABL4 Antibody (NBP1-87170)Learn more about PTMs related to RABL4 Antibody (NBP1-87170).
| Research Areas for RABL4 Antibody (NBP1-87170)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | IFT27 |