RABL4 Antibody

Images

 
Western Blot: RABL4 Antibody [NBP1-87170] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: RABL4 Antibody [NBP1-87170] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RABL4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IFT27
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RABL4 Protein (NBP1-87170PEP)
Publications
Read Publication using NBP1-87170.

Reactivity Notes

Rat (80%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RABL4 Antibody

  • intraflagellar transport 27 homolog (Chlamydomonas)
  • intraflagellar transport protein 27 homolog
  • member of RAS oncogene family-like 4
  • Putative GTP-binding protein RAY-like
  • RABL4
  • Rab-like protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89910
Species: Hu
Applications: IHC, IHC-P
NBP1-88332
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84558
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22411
Species: Rt
Applications: WB, ICC/IF
NB300-822
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-2475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-55756
Species: Hu
Applications: IHC-P
NB120-11427
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
DDX0191P-100
Species: Hu, Mu, Ca, Fe, Sh
Applications: ICC/IF, IHC, IHC-P
NBP2-16927
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB500-180
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, ICC/IF, IP
NBP1-84720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86424
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF873
Species: Hu
Applications: WB
NBP2-02313
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90686
Species: Hu
Applications: IHC, IHC-P
NBP1-87170
Species: Hu
Applications: WB, IHC, IHC-P

Publications for RABL4 Antibody (NBP1-87170)(1)

Reviews for RABL4 Antibody (NBP1-87170) (0)

There are no reviews for RABL4 Antibody (NBP1-87170). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RABL4 Antibody (NBP1-87170) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RABL4 Products

Bioinformatics Tool for RABL4 Antibody (NBP1-87170)

Discover related pathways, diseases and genes to RABL4 Antibody (NBP1-87170). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RABL4 Antibody (NBP1-87170)

Discover more about diseases related to RABL4 Antibody (NBP1-87170).
 

Pathways for RABL4 Antibody (NBP1-87170)

View related products by pathway.

PTMs for RABL4 Antibody (NBP1-87170)

Learn more about PTMs related to RABL4 Antibody (NBP1-87170).
 

Research Areas for RABL4 Antibody (NBP1-87170)

Find related products by research area.

Blogs on RABL4

There are no specific blogs for RABL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RABL4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFT27