Recombinant Human Irisin/FNDC5 Protein

Product Discontinued

Recombinant Human Irisin/FNDC5 Protein Summary

• Description: A recombinant protein with a N-terminal GST tagcorresponding to the amino acids 14 - 78 of Human FNDC5 partial ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:SCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLRTG

• Preparation Method: in vitro wheat germ expression system
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: FNDC5

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Application Notes: This protein is not active and should not be used for experiments requiring activity. This product may contain endotoxins and is not suitable for use with live cells.
• Theoretical MW: 32.89 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Irisin/FNDC5 Protein

• fibronectin type III domain containing 5
• fibronectin type III domain-containing protein 5
• FNDC5
• FRCP2
• FRCP2Fibronectin type III repeat-containing protein 2
• Irisin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: FNDC5