Recombinant Human Irisin/FNDC5 Protein

Images

 
SDS-Page: FNDC5 Partial Recombinant Protein [H00252995-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related Irisin/FNDC5 Peptides and Proteins

Order Details


    • Catalog Number
      H00252995-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Irisin/FNDC5 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 14 - 78 of Human FNDC5 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLRTG

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
FNDC5

Applications/Dilutions

Application Notes
This protein is not active and should not be used for experiments requiring activity. This product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
32.89 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Irisin/FNDC5 Protein

  • fibronectin type III domain containing 5
  • fibronectin type III domain-containing protein 5
  • FNDC5
  • FRCP2
  • FRCP2Fibronectin type III repeat-containing protein 2
  • Irisin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB6158
Species: Hu, Mu
Applications: WB, Simple Western, ICC
MAB29051
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
AF4779
Species: Hu
Applications: WB, IHC
MAB8200
Species: Hu, Mu
Applications: IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-264
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-45691
Species: Hu
Applications: IHC
AF6295
Species: Hu, Mu
Applications: WB, IHC
NBP2-44245
Species: Hu
Applications: WB, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-76602
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for Irisin/FNDC5 Partial Recombinant Protein (H00252995-Q01) (0)

There are no publications for Irisin/FNDC5 Partial Recombinant Protein (H00252995-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Irisin/FNDC5 Partial Recombinant Protein (H00252995-Q01) (0)

There are no reviews for Irisin/FNDC5 Partial Recombinant Protein (H00252995-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Irisin/FNDC5 Partial Recombinant Protein (H00252995-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Irisin/FNDC5 Products

Bioinformatics Tool for Irisin/FNDC5 Partial Recombinant Protein (H00252995-Q01)

Discover related pathways, diseases and genes to Irisin/FNDC5 Partial Recombinant Protein (H00252995-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Irisin/FNDC5 Partial Recombinant Protein (H00252995-Q01)

Discover more about diseases related to Irisin/FNDC5 Partial Recombinant Protein (H00252995-Q01).
 

Pathways for Irisin/FNDC5 Partial Recombinant Protein (H00252995-Q01)

View related products by pathway.

PTMs for Irisin/FNDC5 Partial Recombinant Protein (H00252995-Q01)

Learn more about PTMs related to Irisin/FNDC5 Partial Recombinant Protein (H00252995-Q01).

Blogs on Irisin/FNDC5

There are no specific blogs for Irisin/FNDC5, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Irisin/FNDC5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FNDC5
Entrez