Recombinant Human Irisin/FNDC5 Protein Summary
| Description |
A recombinant protein with a N-terminal GST tagcorresponding to the amino acids 14 - 78 of Human FNDC5 partial ORF Source: Wheat Germ (in vitro) Amino Acid Sequence:SCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLRTG |
Preparation Method |
in vitro wheat germ expression system |
| Protein/Peptide Type |
Partial Recombinant Protein |
| Gene |
FNDC5 |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- SDS-Page
- Western Blot
|
| Application Notes |
This protein is not active and should not be used for experiments requiring activity. This product may contain endotoxins and is not suitable for use with live cells. |
| Theoretical MW |
32.89 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human Irisin/FNDC5 Protein
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Gt, Ha, Hu, Mu, Po, Rt, Sh, Sq
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
Species: Hu, Mu
Applications: ICC, ICFlow, Simple Western, WB
Species: Hu
Applications: ELISA, ICC, WB
Species: Mu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: IHC
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: BA
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, MiAr, WB
Species: Hu
Applications: BA
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP
Publications for Irisin/FNDC5 Partial Recombinant Protein (H00252995-Q01) (0)
There are no publications for Irisin/FNDC5 Partial Recombinant Protein (H00252995-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Irisin/FNDC5 Partial Recombinant Protein (H00252995-Q01) (0)
There are no reviews for Irisin/FNDC5 Partial Recombinant Protein (H00252995-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Irisin/FNDC5 Partial Recombinant Protein (H00252995-Q01) (0)
Additional Irisin/FNDC5 Products
Research Areas for Irisin/FNDC5 Partial Recombinant Protein (H00252995-Q01)
Find related products by research area.
|
Blogs on Irisin/FNDC5