IRF8 Antibody

Images

 
Western Blot: IRF8 Antibody [NBP1-83123] - Analysis in human cell line THP-1.
Immunocytochemistry/ Immunofluorescence: IRF8 Antibody [NBP1-83123] - Staining of human cell line CACO-2 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: IRF8 Antibody [NBP1-83123] - Staining of human lymph node shows distinct nuclear positivity in germinal center cells.
Western Blot: IRF8 Antibody [NBP1-83123] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human cell line A-431

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IRF8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IRF8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IRF8 Protein (NBP1-83123PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IRF8 Antibody

  • ICSBP1
  • ICSBPH-ICSBP
  • interferon consensus sequence binding protein 1
  • Interferon consensus sequence-binding protein
  • interferon regulatory factor 8
  • IRF8
  • IRF-8ICSBP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4715
Species: Mu
Applications: WB
NBP1-31207
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
AF4049
Species: Hu
Applications: WB, Simple Western
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
AF5525
Species: Hu
Applications: WB, IHC
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
AF5629
Species: Hu, Mu
Applications: WB
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, Simple Western, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
MAB8400
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC

Publications for IRF8 Antibody (NBP1-83123) (0)

There are no publications for IRF8 Antibody (NBP1-83123).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IRF8 Antibody (NBP1-83123) (0)

There are no reviews for IRF8 Antibody (NBP1-83123). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IRF8 Antibody (NBP1-83123) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IRF8 Products

Bioinformatics Tool for IRF8 Antibody (NBP1-83123)

Discover related pathways, diseases and genes to IRF8 Antibody (NBP1-83123). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IRF8 Antibody (NBP1-83123)

Discover more about diseases related to IRF8 Antibody (NBP1-83123).
 

Pathways for IRF8 Antibody (NBP1-83123)

View related products by pathway.

PTMs for IRF8 Antibody (NBP1-83123)

Learn more about PTMs related to IRF8 Antibody (NBP1-83123).

Blogs on IRF8

There are no specific blogs for IRF8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IRF8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IRF8
Entrez