IRF2 Antibody (3B5)

Images

 
Western Blot: IRF2 Antibody (3B5) [H00003660-M02] - Analysis of IRF2 expression in transfected 293T cell line by IRF2 monoclonal antibody (M02), clone 3B5.Lane 1: IRF2 transfected lysate(39.4 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: IRF2 Antibody (3B5) [H00003660-M02] - Analysis of monoclonal antibody to IRF2 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: IRF2 Antibody (3B5) [H00003660-M02] - Analysis of monoclonal antibody to IRF2 on formalin-fixed paraffin-embedded human leiomyosarcoma. Antibody concentration 3 ug/ml.
Western Blot: IRF2 Antibody (3B5) [H00003660-M02] - IRF2 monoclonal antibody (M02), clone 3B5 Analysis of IRF2 expression in Hela S3 NE.
Sandwich ELISA: IRF2 Antibody (3B5) [H00003660-M02] - Detection limit for recombinant GST tagged IRF2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
3B5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IRF2 Antibody (3B5) Summary

Immunogen
IRF2 (NP_002190, 216 a.a. ~ 315 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSS
Localization
Nuclear
Specificity
IRF2 - interferon regulatory factor 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IRF2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IRF2 Antibody (3B5)

  • DKFZp686F0244
  • interferon regulatory factor 2
  • IRF2
  • IRF-2

Background

IRF2 encodes interferon regulatory factor 2, a member of the interferon regulatory transcription factor (IRF) family. IRF2 competitively inhibits the IRF1-mediated transcriptional activation of interferons alpha and beta, and presumably other genes that employ IRF1 for transcription activation. However, IRF2 also functions as a transcriptional activator of histone H4.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67330
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
AF5366
Species: Hu, Mu, Rt
Applications: Simple Western, WB
NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
8499-IF/CF
Species: Hu
Applications: BA
AF2894
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
AF5117
Species: Hu
Applications: IHC, WB
NBP2-16991
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
6507-IL/CF
Species: Hu
Applications: BA
NBP2-07996
Species: Hu
Applications: WB
NBP2-59072
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
D6050
Species: Hu
Applications: ELISA
H00008294-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00008363-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00008362-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
NBL1-11567
Species: Hu
Applications: WB
H00003660-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA

Publications for IRF2 Antibody (H00003660-M02) (0)

There are no publications for IRF2 Antibody (H00003660-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IRF2 Antibody (H00003660-M02) (0)

There are no reviews for IRF2 Antibody (H00003660-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IRF2 Antibody (H00003660-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IRF2 Products

Bioinformatics Tool for IRF2 Antibody (H00003660-M02)

Discover related pathways, diseases and genes to IRF2 Antibody (H00003660-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IRF2 Antibody (H00003660-M02)

Discover more about diseases related to IRF2 Antibody (H00003660-M02).
 

Pathways for IRF2 Antibody (H00003660-M02)

View related products by pathway.

PTMs for IRF2 Antibody (H00003660-M02)

Learn more about PTMs related to IRF2 Antibody (H00003660-M02).
 

Research Areas for IRF2 Antibody (H00003660-M02)

Find related products by research area.

Blogs on IRF2

There are no specific blogs for IRF2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IRF2 Antibody (3B5) and receive a gift card or discount.

Bioinformatics

Gene Symbol IRF2
Entrez
OMIM
Uniprot