IRAK2 Recombinant Protein Antigen

Images

 
There are currently no images for IRAK2 Protein (NBP2-38629PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IRAK2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IRAK2.

Source: E. coli

Amino Acid Sequence: AFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVYRGHRHGKPFVFKKL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IRAK2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38629.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IRAK2 Recombinant Protein Antigen

  • interleukin-1 receptor associated kinase-2
  • interleukin-1 receptor-associated kinase 2
  • interleukin-1 receptor-associated kinase-like 2
  • IRAK2
  • IRAK-2
  • MGC150550

Background

IRAK2 encodes the interleukin-1 receptor-associated kinase 2, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. IRAK2 is reported to participate in the IL1-induced upregulation of NF-kappaB. The pro-inflammatory cytokine IL-1 induces cellular response through two subunits of its receptor, IL-1 receptor I (IL-1RI) and IL-1 receptor accessory protein (IL-1RAcP). IL-1 receptor-associated kinase (IRAK) mediates activation of NF-kB, which is a pivotal transcription factor mediating inflammatory and immune response. A novel member in the IRAK/Pelle family was recently identified and designated IRAK2 (1). Both IRAK and IRAK2 recruit to the subunits of the IL-1R complex after IL-1 binding and lead to NF-kB activation. IRAKs also associate with Toll-like receptor (TLR) and the dominant negative mutants of IRAKs inhibit LPS-induced NF-kB activation (2,3).Members in IRAK/Pelle family play a central role in IL-1R and TLR mediated inflammatory response. IRAK2 is expressed in a variety of human tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77068
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
NBP2-26506
Species: Hu, Mu, Rt
Applications: B/N, In vitro
201-LB
Species: Hu
Applications: BA
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP2-29328
Species: Bv, Hu, Mu, Rt, Xp, Ye, Ze
Applications: BindInhib, B/N, ELISA, Flow, Func-Inh, IHC, In vitro, In vivo
NB100-56722
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
NB500-597
Species: Hu, Mu, Rt
Applications: Flow, IP, WB
M6000B
Species: Mu
Applications: ELISA
AF6264
Species: Hu
Applications: Simple Western, WB
DY417
Species: Mu
Applications: ELISA
NBP2-52508
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC, ICC/IF, IHC,  IHC-P, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-24729
Species: Ca, Eq, Hu, Pm, Mu, Pm, Rt
Applications: B/N, CyTOF-ready, DB, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC,  IHC-P, IP, In vitro, KD, Simple Western, WB
NBP2-26245
Species: Hu, Mu
Applications: Flow, In vitro
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-48284
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-38629PEP
Species: Hu
Applications: AC

Publications for IRAK2 Protein (NBP2-38629PEP) (0)

There are no publications for IRAK2 Protein (NBP2-38629PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IRAK2 Protein (NBP2-38629PEP) (0)

There are no reviews for IRAK2 Protein (NBP2-38629PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IRAK2 Protein (NBP2-38629PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IRAK2 Products

Array NBP2-38629PEP

Research Areas for IRAK2 Protein (NBP2-38629PEP)

Find related products by research area.

Blogs on IRAK2

There are no specific blogs for IRAK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IRAK2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IRAK2