Recombinant Human INTU Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human INTU Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-408 of Human INTU full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MASVASCDSRPSSDELPGDPSSQEEDEDYDFEDRVSDSGSYSSASSDYDDLEPEWLDSVQKNGELFYLELSEDEEESLLPETPTVNHVRFSENEIIIEDDYKERKKYEPKLKQFTKILRRKRLLPKRCNKKNSNDNGPVSILKHQSNQKTGVIVQQRYKDVNVYVNPKKLTVIKAKEQLKLLEVLVGIIHQTKWSWRRTGKQGDGERLVVHGLLPGGSAMKSGQVLIGDVLVAVNDVDVTTENIERVLSCIPGPMQVKLTFENAYDVKRETSHPRQKKTQSNTSDLVKLLWGEEVEGIQQSGLNTPHIIMYLTLQLDSETSKEEQEILYHYPMSEASQKLKSVRGIFLTLCDMLENVTGTQVTSSSLLLNGKQIHVAYWKESDKLLLIGLPAEEIELPSSAHTHGERN

Protein/Peptide Type
Recombinant Protein
Gene
INTU

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human INTU Protein

  • FLJ41326
  • inturned planar cell polarity effector homolog (Drosophila)
  • Inturned planar cell polarity effector homolog
  • KIAA1284INT
  • PDZ domain containing 6
  • PDZ domain-containing protein 6
  • PDZD6
  • PDZK6homolog of inturned

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4409
Species: Mu
Applications: WB
NBP1-91875
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF7164
Species: Hu
Applications: WB
NBP1-89165
Species: Hu
Applications: IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for INTU Recombinant Protein (H00027152-P01) (0)

There are no publications for INTU Recombinant Protein (H00027152-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INTU Recombinant Protein (H00027152-P01) (0)

There are no reviews for INTU Recombinant Protein (H00027152-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for INTU Recombinant Protein (H00027152-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional INTU Products

Bioinformatics Tool for INTU Recombinant Protein (H00027152-P01)

Discover related pathways, diseases and genes to INTU Recombinant Protein (H00027152-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for INTU Recombinant Protein (H00027152-P01)

Discover more about diseases related to INTU Recombinant Protein (H00027152-P01).
 

Pathways for INTU Recombinant Protein (H00027152-P01)

View related products by pathway.

Blogs on INTU

There are no specific blogs for INTU, but you can read our latest blog posts.

Customers Who Bought This Also Bought

INTU Antibody
NBP1-81420
IL-4 [Unconjugated]
204-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human INTU Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol INTU