INTS6 Antibody

Images

 
Western Blot: INTS6 Antibody [NBP1-88029] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17.1. Lane 2: Human cell line RT-4. Lane 3: Human cell line EFO-21. Lane 4: Human cell line A-431. Lane 5: Human liver ...read more
Immunohistochemistry: INTS6 Antibody [NBP1-88029] - Staining of human hippocampus shows strong nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

INTS6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KYELEPSPLTQFILERKSPQTCWQVYVSNSAKYSELGHPFGYLKASTALNCVNLFVMPYNYPVLLPLLDDLFKVHKAKPTLKWRQSFESYLKTMPPYYLGPLKKAVRMMGAPNLIADSMEYGLSYSVISYLKKLSQQAKIES
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
INTS6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
INTS6 Protein (NBP1-88029PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for INTS6 Antibody

  • DBI1
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 26
  • DICE1DBI-1DDX26ADDX26DEAD box protein
  • DKFZp434B105
  • HDB
  • INT6
  • integrator complex subunit 6
  • Notchl2
  • Protein DDX26
  • Protein deleted in cancer 1
  • RNA helicase HDB

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NBP1-84869
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-44179
Species: Mu
Applications: WB, ELISA
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
NBP1-84407
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-76491
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF6116
Species: Hu
Applications: WB, ICC
NBP1-84382
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5629
Species: Hu, Mu
Applications: WB
NB120-2813
Species: Hu, Mu, Ch, Rb
Applications: WB, ICC/IF, IP
NB200-603
Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-Fr, IHC-P, IP, IF
NBP1-88029
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for INTS6 Antibody (NBP1-88029) (0)

There are no publications for INTS6 Antibody (NBP1-88029).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INTS6 Antibody (NBP1-88029) (0)

There are no reviews for INTS6 Antibody (NBP1-88029). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for INTS6 Antibody (NBP1-88029) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional INTS6 Products

Bioinformatics Tool for INTS6 Antibody (NBP1-88029)

Discover related pathways, diseases and genes to INTS6 Antibody (NBP1-88029). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for INTS6 Antibody (NBP1-88029)

Discover more about diseases related to INTS6 Antibody (NBP1-88029).
 

Pathways for INTS6 Antibody (NBP1-88029)

View related products by pathway.

PTMs for INTS6 Antibody (NBP1-88029)

Learn more about PTMs related to INTS6 Antibody (NBP1-88029).
 

Research Areas for INTS6 Antibody (NBP1-88029)

Find related products by research area.

Blogs on INTS6

There are no specific blogs for INTS6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our INTS6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol INTS6