Intron-Binding Protein Of 160 KDa Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Intron-Binding Protein Of 160 KDa Antibody [NBP2-55806] - Staining of human cell line U-2 OS shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Intron-Binding Protein Of 160 KDa Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DEWEGLRKHDVCFLITVRPTKPYGTKFDRRRPFIEQVGLVYVRGCEIQGMLDDKGRVIEDGPEPRPNLRGESRTFRVFLDPNQYQQDMTNTIQNGAEDVYETFNI
Specificity
Specificity of human Intron-Binding Protein Of 160 KDa antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AQR
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Intron-Binding Protein Of 160 KDa Recombinant Protein Antigen (NBP2-55806PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Intron-Binding Protein Of 160 KDa Antibody

  • AQR
  • aquarius homolog (mouse)
  • FSAP164
  • Functional Spliceosome-Associated Protein 164
  • IBP160
  • Intron-Binding Protein Aquarius

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-44643
Species: Hu
Applications: Flow, ICC/IF, CyTOF-ready
NBP2-67691
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NB100-1892
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NBP2-93935
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-75531
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90300
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-00178
Species: Hu, Mu, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB120-6405
Species: Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC

Publications for Intron-Binding Protein Of 160 KDa Antibody (NBP2-55806) (0)

There are no publications for Intron-Binding Protein Of 160 KDa Antibody (NBP2-55806).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Intron-Binding Protein Of 160 KDa Antibody (NBP2-55806) (0)

There are no reviews for Intron-Binding Protein Of 160 KDa Antibody (NBP2-55806). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Intron-Binding Protein Of 160 KDa Antibody (NBP2-55806) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Intron-Binding Protein Of 160 KDa Products

Bioinformatics Tool for Intron-Binding Protein Of 160 KDa Antibody (NBP2-55806)

Discover related pathways, diseases and genes to Intron-Binding Protein Of 160 KDa Antibody (NBP2-55806). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Intron-Binding Protein Of 160 KDa Antibody (NBP2-55806)

Discover more about diseases related to Intron-Binding Protein Of 160 KDa Antibody (NBP2-55806).
 

Pathways for Intron-Binding Protein Of 160 KDa Antibody (NBP2-55806)

View related products by pathway.

Blogs on Intron-Binding Protein Of 160 KDa

There are no specific blogs for Intron-Binding Protein Of 160 KDa, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Intron-Binding Protein Of 160 KDa Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AQR