Integrin beta 8 Antibody (CL7290)

Images

 
Western Blot: Integrin beta 8 Antibody (CL7290) [NBP2-76480] - Analysis in human eye tissue.
Immunocytochemistry/ Immunofluorescence: Integrin beta 8 Antibody (CL7290) [NBP2-76480] - Staining of EFO-21 cells showing specific staining in the plasma membrane. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clone
CL7290
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Integrin beta 8 Antibody (CL7290) Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AQHCVNSKGQVCSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCALMEQQHY
Epitope
SQAILDQCKTSCALM
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
ITGB8
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 2-10 ug/ml
  • Western Blot 1 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Integrin beta 8 Antibody (CL7290)

  • Integrin beta 8
  • integrin beta-8
  • integrin, beta 8
  • ITGB8

Background

The Integrin beta 8 gene is a member of the integrin beta chain family and encodes a single-pass type I membrane protein with a VWFA domain and four cysteine-rich repeats. This protein noncovalently binds to an alpha subunit to form a heterodimeric integrin complex. In

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7754-BH/CF
Species: Hu
Applications: BA
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
AF3628
Species: Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, WB
H00055835-M02
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
NBP1-86658
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-81798
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00000053-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
221-AA
Species: Hu
Applications: BA
NBP1-04266
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-87109
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-90080
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-82847
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
AF5269
Species: Hu, Mu
Applications: IHC, WB
3050-AV
Species: Hu
Applications: Bind
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
NBP2-76480
Species: Hu
Applications: WB, ICC/IF

Publications for Integrin beta 8 Antibody (NBP2-76480) (0)

There are no publications for Integrin beta 8 Antibody (NBP2-76480).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin beta 8 Antibody (NBP2-76480) (0)

There are no reviews for Integrin beta 8 Antibody (NBP2-76480). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Integrin beta 8 Antibody (NBP2-76480) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Integrin beta 8 Products

Bioinformatics Tool for Integrin beta 8 Antibody (NBP2-76480)

Discover related pathways, diseases and genes to Integrin beta 8 Antibody (NBP2-76480). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin beta 8 Antibody (NBP2-76480)

Discover more about diseases related to Integrin beta 8 Antibody (NBP2-76480).
 

Pathways for Integrin beta 8 Antibody (NBP2-76480)

View related products by pathway.

PTMs for Integrin beta 8 Antibody (NBP2-76480)

Learn more about PTMs related to Integrin beta 8 Antibody (NBP2-76480).
 

Research Areas for Integrin beta 8 Antibody (NBP2-76480)

Find related products by research area.

Blogs on Integrin beta 8

There are no specific blogs for Integrin beta 8, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin beta 8 Antibody (CL7290) and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGB8