Integrin beta 8 Antibody (CL7290) Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: AQHCVNSKGQVCSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCALMEQQHY |
Epitope |
SQAILDQCKTSCALM |
Isotype |
IgG1 |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
ITGB8 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/Immunofluorescence 2-10 ug/ml
- Western Blot 1 ug/ml
|
Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, pH 7.2, containing 40% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Protein A purified |
Alternate Names for Integrin beta 8 Antibody (CL7290)
Background
The Integrin beta 8 gene is a member of the integrin beta chain family and encodes a single-pass type I membrane protein with a VWFA domain and four cysteine-rich repeats. This protein noncovalently binds to an alpha subunit to form a heterodimeric integrin complex. In
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, Simple Western, WB
Species: Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
Species: Hu, Mu
Applications: IHC, WB
Species: Hu
Applications: Bind
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB, ICC/IF
Publications for Integrin beta 8 Antibody (NBP2-76480) (0)
There are no publications for Integrin beta 8 Antibody (NBP2-76480).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Integrin beta 8 Antibody (NBP2-76480) (0)
There are no reviews for Integrin beta 8 Antibody (NBP2-76480).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Integrin beta 8 Antibody (NBP2-76480) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Integrin beta 8 Products
Bioinformatics Tool for Integrin beta 8 Antibody (NBP2-76480)
Discover related pathways, diseases and genes to Integrin beta 8 Antibody (NBP2-76480). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Integrin beta 8 Antibody (NBP2-76480)
Discover more about diseases related to Integrin beta 8 Antibody (NBP2-76480).
| | Pathways for Integrin beta 8 Antibody (NBP2-76480)
View related products by pathway.
|
PTMs for Integrin beta 8 Antibody (NBP2-76480)
Learn more about PTMs related to Integrin beta 8 Antibody (NBP2-76480).
| | Research Areas for Integrin beta 8 Antibody (NBP2-76480)
Find related products by research area.
|
Blogs on Integrin beta 8