Integrin beta 5 Antibody (2C4) - Azide and BSA Free Summary
Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen |
ITGB5 (NP_002204, 421 a.a. ~ 516 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREA |
Specificity |
ITGB5 - integrin, beta 5 |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
ITGB5 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Flow Cytometry
- Immunocytochemistry/ Immunofluorescence
- Knockdown Validated
- Western Blot 1:500
|
Application Notes |
Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA. |
Publications |
|
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Integrin beta 5 Antibody (2C4) - Azide and BSA Free
Background
Integrins are heterodimers composed of noncovalently associated transmembrane
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, I, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P, IP, KD, MiAr, Simple Western, Single-Cell Western, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
Species: Hu, Mu
Applications: ICC/IF, IHC-P, WB
Species: Mu, Rt
Applications: ICC, Simple Western, WB
Species: Mu
Applications: Dual ISH-IHC, IHC, WB
Species: Mu
Applications: Flow, IHC, Neut, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, PEP-ELISA, WB
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC, IP
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, KD
Publications for Integrin beta 5 Antibody (H00003693-M01)(3)
Showing Publications 1 -
3 of 3.
Publications using H00003693-M01 |
Applications |
Species |
D Zang, C Zhang, C Li, Y Fan, Z Li, K Hou, X Che, Y Liu, X Qu LPPR4 promotes peritoneal metastasis via Sp1/integrin &alpha/FAK signaling in gastric cancer Am J Cancer Res, 2020-03-01;10(3):1026-1044. 2020-03-01 [PMID: 32266108] |
|
|
Sa S, Wong L, McCloskey KE. Combinatorial fibronectin and laminin signaling promote highly efficient cardiac differentiation of human embryonic stem cells. Biores Open Access 2014-08-01 [PMID: 25126479] |
|
|
Ballana E, Pauls E, Clotet B et al. beta5 integrin is the major contributor to the alphaVintegrin-mediated blockade of HIV-1 replication. J Immunol. 2010-11-22 [PMID: 21098231] |
|
|
Reviews for Integrin beta 5 Antibody (H00003693-M01) (0)
There are no reviews for Integrin beta 5 Antibody (H00003693-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Integrin beta 5 Antibody (H00003693-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Integrin beta 5 Products
Research Areas for Integrin beta 5 Antibody (H00003693-M01)
Find related products by research area.
|
Blogs on Integrin beta 5