Integrin beta 5 Antibody (1D8)

Images

 
There are currently no images for Integrin beta 5 Antibody (H00003693-M02).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1D8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Integrin beta 5 Antibody (1D8) Summary

Immunogen
ITGB5 (NP_002204 421 a.a. - 516 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREA
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ITGB5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Integrin beta 5 Antibody (1D8)

  • FLJ26658
  • Integrin beta 5
  • integrin beta-5
  • integrin, beta 5
  • ITGB5

Background

Integrins are heterodimers composed of noncovalently associated transmembrane alpha and beta subunits. The 16alpha and 8beta subunits heterodimerize to produce more than 20 different receptors. Most Integrin receptors bind ligands that are components of the extracellular matrix, including Fibronectin, Collagen and Vitronectin. Certain Integrins can also bind to soluble ligands such as Fibrinogen, or to counterreceptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), leading to aggregation of cells. Ligands serve to cross-link or cluster Integrins by binding to adjacent Integrin receptors; both receptor clustering and ligand occupancy are necessary for the activation of Integrinmediated responses. In addition to mediating cell adhesion and cytoskeletal organization, Integrins function as signaling receptors. Signals transduced by Integrins play a role in many biological processes, including cell growth, differentiation, migration and apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
BBA37
Species: Hu
Applications: AdBlk
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-82991
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NBP1-05987
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
NBP2-27418
Species: Hu, Pm
Applications: WB
AF4076
Species: Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
AF385
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
AF1219
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
NBP1-85747
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, IP
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00003693-M02
Species: Hu
Applications: WB, ELISA

Publications for Integrin beta 5 Antibody (H00003693-M02) (0)

There are no publications for Integrin beta 5 Antibody (H00003693-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin beta 5 Antibody (H00003693-M02) (0)

There are no reviews for Integrin beta 5 Antibody (H00003693-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Integrin beta 5 Antibody (H00003693-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Integrin beta 5 Products

Bioinformatics Tool for Integrin beta 5 Antibody (H00003693-M02)

Discover related pathways, diseases and genes to Integrin beta 5 Antibody (H00003693-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin beta 5 Antibody (H00003693-M02)

Discover more about diseases related to Integrin beta 5 Antibody (H00003693-M02).
 

Pathways for Integrin beta 5 Antibody (H00003693-M02)

View related products by pathway.

PTMs for Integrin beta 5 Antibody (H00003693-M02)

Learn more about PTMs related to Integrin beta 5 Antibody (H00003693-M02).
 

Research Areas for Integrin beta 5 Antibody (H00003693-M02)

Find related products by research area.

Blogs on Integrin beta 5

There are no specific blogs for Integrin beta 5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin beta 5 Antibody (1D8) and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGB5
Entrez
Uniprot