Integrin beta 5 Antibody (1D8) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
ITGB5 (NP_002204, 421 a.a. ~ 516 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREA |
| Isotype |
IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
ITGB5 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
It has been used for ELISA and WB. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Integrin beta 5 Antibody (1D8) - Azide and BSA Free
Background
Integrins are heterodimers composed of noncovalently associated transmembrane alpha and beta subunits. The 16alpha and 8beta subunits heterodimerize to produce more than 20 different receptors. Most Integrin receptors bind ligands that are components of the extracellular matrix, including Fibronectin, Collagen and Vitronectin. Certain Integrins can also bind to soluble ligands such as Fibrinogen, or to counterreceptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), leading to aggregation of cells. Ligands serve to cross-link or cluster Integrins by binding to adjacent Integrin receptors; both receptor clustering and ligand occupancy are necessary for the activation of Integrinmediated responses. In addition to mediating cell adhesion and cytoskeletal organization, Integrins function as signaling receptors. Signals transduced by Integrins play a role in many biological processes, including cell growth, differentiation, migration and apoptosis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, I, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP-EXO-SEQ, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P, IP, KD, MiAr, Simple Western, Single-Cell Western, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
Species: Hu, Mu
Applications: ICC/IF, IHC-P, WB
Species: Mu, Rt
Applications: ICC, Simple Western, WB
Species: Mu
Applications: Dual ISH-IHC, IHC, WB
Species: Mu
Applications: Flow, IHC, Neut, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, PEP-ELISA, WB
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC, IP
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Hu
Applications: WB, ELISA
Publications for Integrin beta 5 Antibody (H00003693-M02) (0)
There are no publications for Integrin beta 5 Antibody (H00003693-M02).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Integrin beta 5 Antibody (H00003693-M02) (0)
There are no reviews for Integrin beta 5 Antibody (H00003693-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Integrin beta 5 Antibody (H00003693-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Integrin beta 5 Products
Research Areas for Integrin beta 5 Antibody (H00003693-M02)
Find related products by research area.
|
Blogs on Integrin beta 5