Integrin beta 3/CD61 Antibody

Images

 
Immunohistochemistry-Paraffin: Integrin beta 3/CD61 Antibody [NBP1-83453] - EFCAB13 Antibody [NBP1-83453] - Staining of human bone marrow shows strong cytoplasmic positivity in megakaryocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Integrin beta 3/CD61 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITGB3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Integrin beta 3/CD61 Recombinant Protein Antigen (NBP1-83453PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Integrin beta 3/CD61 Antibody

  • CD61 antigen
  • CD61
  • GP3A
  • GP3Aplatelet glycoprotein IIIa
  • GPIIIA
  • GPIIIaintegrin beta-3
  • INGRB3
  • Integrin beta 3
  • integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61)
  • ITG B3
  • ITGB3
  • Platelet membrane glycoprotein IIIa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-83453
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Integrin beta 3/CD61 Antibody (NBP1-83453) (0)

There are no publications for Integrin beta 3/CD61 Antibody (NBP1-83453).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin beta 3/CD61 Antibody (NBP1-83453) (0)

There are no reviews for Integrin beta 3/CD61 Antibody (NBP1-83453). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Integrin beta 3/CD61 Antibody (NBP1-83453) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Integrin beta 3/CD61 Products

Bioinformatics Tool for Integrin beta 3/CD61 Antibody (NBP1-83453)

Discover related pathways, diseases and genes to Integrin beta 3/CD61 Antibody (NBP1-83453). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin beta 3/CD61 Antibody (NBP1-83453)

Discover more about diseases related to Integrin beta 3/CD61 Antibody (NBP1-83453).
 

Pathways for Integrin beta 3/CD61 Antibody (NBP1-83453)

View related products by pathway.

PTMs for Integrin beta 3/CD61 Antibody (NBP1-83453)

Learn more about PTMs related to Integrin beta 3/CD61 Antibody (NBP1-83453).
 

Research Areas for Integrin beta 3/CD61 Antibody (NBP1-83453)

Find related products by research area.

Blogs on Integrin beta 3/CD61

There are no specific blogs for Integrin beta 3/CD61, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin beta 3/CD61 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGB3
Entrez